KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW015924Help
Entry
IscW_ISCW015924   CDS       T01131                                 

Definition
ubiquitin carboxyl-terminal hydrolase, putative (EC:3.1.2.15)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:isc04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1139 aa AA seqDB search
MRSLRDPDYPRCPARESTIAAAILFIFMLRAAAIVSLGVPCKVRFVVAWFPLSGGLTPAD
IGRIASKHVKVTVSGKNPLAAGKERSNSSARSKRNAATRDTTAAVGLIMNHAVLHDKDSG
QADLEEMDTQEGDENVAPPPSQQQQQPPQPTQQAQPLHHPPPPPPPETGGRERFANGVSP
AVPAAAAAPDGLDEPMEEEDEARSEATFRFVVTGFSRLRESVLSPATQVRNLPWKIMVMP
RTNAGNDRTPTKSLGFFLQCNGESESSTWSCNATAELRIISQKEGVDNFVRKIQHLFYSK
ENDWGFSHFMTWTDVLDPEKGFILDDTIILEVWVSADAPHGVSWDSKKHTGYVGLKNQGA
TCYMNSLLQTLFFTNQLRKAVYQMPTESDDSSKSVALALQRVFYELQFSDKPVGTKKLTK
SFGWETLDSFMQHDVQELCRVLLDNMESKMKGTCVEGTIPRLFEGKMISFIKCKHVEYTS
RRMEPFYDIQLNVKGKKNIHESFQDYCATESLDGENKYDAGEYGLQEAEKGIIFACLPPV
VHLHLLRFQYDPLTDNNVKLNDRFEDVVAAFSNALPTEAPSTFPQGPSPATYTLHAVLVH
SGDNHGGHYVVFINPRGDGRWCKFDDDVVSRCTKQEAIDHNFGGTEDDVAVSRHCTNAYM
LVYIRDSAIILTVATVGCESWISPDFRLAIIWRQEALRRKERNEAHLYMSVQVLTEDSFA
GHQGNDLYDPEKASYRSFKVKKQATLRDLLDLIADQMRFPLHAIRPWSITYRSNQTFRPA
AVDLDADLNKTVIDLSENANPWTIFLETIVPDQPMDRLPEFDKETDVLLFFKMYDPRLKQ
IAYCGHTYMPITVKAKELVPLLNKRAGFPPDTELVLYEEVKPNIVDRIEDLELPLEKVLE
ELMDGDIIVFQKLDHNADEYELPTVKDYFRDLFYRVEVTFCDKSIANDPGFTMELSLKMN
YDQIARAVAQRLGTDPYLLQFFKVQSYREGPGNPLRCTYEGTLKDLLVFFKPRQPKKIYY
QQLSIRINELESKKQFKCVWVNSKFKEEREPFTKVKDRIQKKLDIPDKEFEKYKFAIVVM
GRAQFIEDADYVVNLQDFMAQPPQGAAMHPRPWLGIEHINKAPKRSRYNYLEKAIKIHN
NT seq 3420 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccttgcgggatcccgactacccaagatgccccgcgcgcgaatccaccatagcc
gcggccatcttgtttattttcatgctccgtgccgccgcgatcgtgagtctcggcgtcccc
tgcaaagtccgttttgtcgtcgcatggtttcccctgtccggggggctgacaccagcagac
attgggcgaatcgcgagcaagcacgtcaaagtgacagtgtccggcaaaaaccccctggcc
gcaggcaaagaacgctccaacagctctgcccgatctaagcgcaacgccgccacccgtgac
accacagctgccgtcggacttataatgaaccacgctgttcttcatgacaaggacagcggt
caggcagacttggaggaaatggatacacaagaaggtgacgaaaacgtggcccctccaccg
tcgcagcagcagcagcagccgccacagccgacccagcaggcccagcccctgcaccacccg
ccgccccctcccccgcccgagacgggcgggcgggagcgctttgccaacggcgtgtccccc
gcggtgccggcggcagcggcggcgccagatggcctcgatgagcccatggaggaggaggac
gaggcccggtcagaggccaccttccgctttgtggtgacgggcttctcgaggctgcgggag
tcagtgctcagtccggccacccaagtgcgcaacctcccctggaaaatcatggtgatgccg
cgcacgaatgcgggcaacgaccggacgccaaccaaaagtctgggcttcttcctacaatgc
aacggcgagtcggagtcctcgacatggtcatgcaacgcgacggcagagcttcgcatcatc
agccagaaggagggcgtcgacaacttcgtaagaaaaatccagcacctattctatagcaag
gagaacgactggggattcagtcacttcatgacgtggacggacgttctcgatccggagaaa
gggttcattctggacgacaccatcatcctggaggtgtgggtgtcggcggacgcacctcac
ggggtcagctgggactccaaaaagcacacgggctacgtgggcctgaagaaccagggtgcc
acgtgctacatgaactccctcctgcagacactcttcttcacgaatcagctccgcaaggcg
gtgtaccagatgccgacggagagcgacgactcgtccaagagcgtggcgctggcgctacag
cgggtcttctacgagctgcagttctcggacaagcccgtgggcaccaagaagctcacgaag
tccttcggctgggagacgctcgactcttttatgcagcacgacgtccaggagctgtgtaga
gtgctgctggacaacatggagagcaagatgaagggcacctgcgtggagggcaccatcccc
cggctctttgagggcaagatgatctcgttcatcaagtgcaagcacgtggagtacacctcc
aggcgcatggagcccttctacgacatccagctcaatgtcaagggcaagaagaacatccac
gagtccttccaggactactgcgccacggagagcctggacggggagaacaagtacgacgca
ggggagtacgggctgcaggaggcggagaaaggcatcattttcgcctgcctgccccccgtg
gtgcacctgcacctgctgcgcttccagtacgaccccctcacggacaacaacgtcaagctc
aacgaccgctttgaagacgtcgtcgcggcgttttccaatgcgttgccgaccgaggcaccc
tctacgttcccccagggcccgagcccggcgacgtacaccctgcacgcggtgctggtgcac
tccggggacaaccacgggggccactatgtggtgttcatcaacccccggggggacgggcgc
tggtgcaagttcgacgacgacgtggtttcgcgctgcaccaagcaggaggccatcgaccac
aacttcgggggcacggaggacgacgtggccgtcagccgccactgcaccaatgcctacatg
ctggtctacatcagggacagcgccatcattcttacggttgccactgtcggctgcgagtct
tggattagtcccgattttcgcttggctattatatggcgccaggaggccctgcggcgcaag
gagcgcaacgaggcgcacctgtacatgagcgtgcaggtgctgacggaggacagctttgcg
ggccaccagggcaacgacctgtacgacccggagaaggcctcttaccgctccttcaaggtg
aagaagcaagccaccctgcgagacctgctggacctgattgcggaccagatgcgcttcccc
ctgcacgccatccggccctggtccatcacctaccgctccaaccaaaccttccggccggcc
gccgtggacctggacgcggacctcaacaagacggtgattgacctgtccgagaacgccaac
ccctggacgatcttcctggagacgatcgtgccggaccagccgatggaccggttgccggag
ttcgacaaagagacggacgtgctgctcttcttcaagatgtacgacccgaggctgaaacag
atcgcctactgcggccacacctacatgcccatcaccgtcaaggccaaggagctggtgccg
ctgctcaacaagagggcggggtttccccctgacacggagctggtgctctacgaggaggtg
aagccaaacattgtggaccgcattgaggacctggagctgcccctggagaaggtcctggag
gagctgatggacggagacataatcgtctttcagaagctggaccacaatgcggacgagtac
gagctgcccaccgtcaaggactacttcagagacctcttctacagggtggaggtgaccttc
tgtgataaatctattgccaatgaccccggcttcacgatggagctttctctcaagatgaac
tatgaccagatcgccagggcggtggcgcaacggctaggcacagacccttatttattacaa
tttttcaaagttcagagttaccgagagggccccggtaaccctctgaggtgtacatacgag
gggacgctcaaggacctcctggtattcttcaagcccaggcagcccaagaagatctattac
cagcagctgagcatacggataaacgagctagaaagcaagaagcagttcaagtgcgtctgg
gtcaacagcaagttcaaggaagagcgggaacccttcacgaaggtcaaggacaggattcag
aagaagctggacatccctgacaaggagttcgaaaagtacaagttcgccattgtcgtaatg
gggcgggcacagttcatcgaggatgcagactacgtggtgaacctgcaagacttcatggcg
caacctcctcaaggtgcggcgatgcacccccgtccctggctgggcatcgaacacatcaac
aaggcacccaagaggtcccgctacaactacctggagaaggccatcaagatccacaactga

DBGET integrated database retrieval system