KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW015969Help
Entry
IscW_ISCW015969   CDS       T01131                                 

Definition
protein disulfide isomerase 3, putative (EC:5.3.4.1)
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    IscW_ISCW015969
Enzymes [BR:isc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     IscW_ISCW015969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 632 aa AA seqDB search
SAGATPEADSDRSAEHDDETVEDESDEDEKTEKDAEDMAEEKEESKVIAIDNDPTFTDID
LIETPMEYRFSPFRCVHCKNMAPEYARAATILREKKPQVLLAKIDTTVQQALSNRFDVNK
YPTLFISHRGKMTEYEGTFSAEGLVDYVSERTDPTWKAPPEATIQLTTETFTPTINAAKI
ILVYFYAPWQWSHSCGHCRRMSPEFERAARRLKDYGIPLAKVDATKEKTLAEVHEVKSYP
TLLVYRKGRRFPYNGPREETGIVNHMKHLSEFPSKEVTSLKQLKKVQGTLDTTILAVLNK
KKGPFYKEYEATANALRGKHLFLHTYSNDIAKHFKVPLDSLVLMHPDLLLSQYEEKFFTL
SKSDATQDHMVRFVDEHLYPLVGHRTAENLWKYITKFPLVVVYYDVDFSFDNRDDTQHIR
NKVLKVAQQYKGRVTFAISNEVEFEDELKHLALEDTGAEVSAGMYQSENERYRMPPTDDF
KSGTLRNFVESVLQGKLKQHIRSELPPKKQNPRVLTVVGSTFHSLITSSDKDTLIMFRSP
DCHMCNEIAEEVAQTALRMEWMVPGAFQAAIIDATLNDYPTTYKMDDYPAIFFVSAVDKQ
HPRPFSGIRKAFALIKFVKENLSTPLPEKFKL
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
tctgccggcgcgactccagaagctgactcggatcgctcggcagagcatgatgacgagacc
gtcgaggatgagtccgacgaagacgagaagacggagaaggatgccgaagacatggcggag
gaaaaggaggaatctaaggttatcgccatcgacaacgaccctacctttaccgatatcgac
ttgatcgaaacacccatggaatatcgcttttctcctttcaggtgtgtgcattgcaaaaat
atggctcccgagtacgccagggctgccaccatcctgcgggagaagaagccccaagtgttg
ctggccaagatagacaccaccgtccagcaggccttgtcgaaccgctttgatgtcaacaag
tacccaaccctgttcatctctcacaggggcaagatgacggagtacgagggaaccttctct
gccgaagggcttgtagactatgtgtcggagagaaccgacccaacatggaaggcgccacca
gaagccaccattcagctcacaaccgagacctttaccccaaccatcaacgctgccaagatt
atactggtttacttctatgctccatggcaatggtcacattcgtgcggtcactgcagacgg
atgtctccggagtttgagcgtgccgcacgtcggctcaaggactatggcatcccattggcc
aaggtggatgccaccaaggagaagaccctagccgaagtgcatgaggtcaagagctacccc
acgctcctcgtgtaccgcaagggccgaaggtttccttacaacgggccccgagaggaaaca
ggcattgtgaatcacatgaagcacctctcggaattcccgagcaaagaggttacgtctctg
aagcagctgaagaaggtccaagggaccttggacactacgatcttggccgtgctcaacaag
aagaaaggtcccttctacaaggagtacgaagctacagcgaatgccctcagggggaaacac
ttgtttttgcatacctactcgaacgacatcgcaaagcacttcaaggtgcctctggattcg
ctcgtcctgatgcaccccgacctgttgctgtctcaatatgaagaaaagttcttcacgtta
agcaagtccgatgccacccaagaccacatggtgcgctttgtggacgagcacctctaccca
ttggttggacaccgcactgcagaaaacttgtggaaatacatcaccaaattccccctggtg
gtggtgtactacgacgtcgacttcagcttcgacaacagggacgacacccagcacatccgc
aacaaggtgttgaaggttgcccagcagtacaagggccgcgtgacctttgccatctccaac
gaggtggagtttgaggacgagctcaagcacctggcactggaggacaccggggcagaggtc
agcgcgggcatgtaccagtcggagaacgagcgctaccgcatgccccccaccgacgacttc
aagagtggcacgctgcgcaactttgtagaatctgtgctccagggcaagctgaagcagcac
atccgatccgagctcccgccgaaaaagcagaaccccagggtgctgacggtggtcggctcc
acgttccactcgctcatcacgtcgtcagacaaggacacgctcatcatgttccgcagccca
gactgccacatgtgcaacgagattgctgaggaggtggcccagacggccctccggatggag
tggatggtgcccggggcgttccaggcggccatcatagacgccaccctcaacgactacccg
accacttacaagatggacgactacccagccattttctttgtttcggcggtggacaagcag
cacccgaggccgttcagcggcatccgaaaggcctttgccctcatcaagtttgtcaaggag
aacctcagcacaccactgccagagaagttcaagctc

DBGET integrated database retrieval system