KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW016161Help
Entry
IscW_ISCW016161   CDS       T01131                                 

Definition
protein disulfide isomerase, putative (EC:2.4.1.119)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:isc04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 486 aa AA seqDB search
MRWFPLLAVLIPAALASDVLDYSADFDTKIQDHDAALVEFFAPWCGHCKRLAPEYEKAAT
ELKTNDPPVPLIKVDCTSDGGKDTCSKHGVSGYPTLKIFRGGEFSADYNGPREAGGIVKY
MKAQVGPSSKELLSVAEVEKYLSKDDVVIFGFFESKDASLHENFLKVADKQREAWTFGHS
FDKDVLKKYGYKNQVVLFRPKILKNKFEESFAVYSGSDDKTELETFIKENYHGLVGHRTQ
DNYNMFQAPLLVAYYDVDYTKNAKGTNYWRNRILKVAQNYKGKLNFAVSNKDSFAAEMDD
YGVTVKANKPAIAVRNSENEKFRMTNDFSVENLEKFLEEYLAGKVKAHLKSEPVPETNDG
PVKVAVAENFKSLVTESTKDVLIEFYAPWCGHCKKLAPTYEEVGKTLADEDVLVVKMDAT
ANDVPSAFEVSGFPTLYWLPKNDKQNPRRYEGGREHDDFIKWIAKHATDELKAYDRSGAK
RAKEEL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggtttcccttgctagcggttttaatccccgctgcgcttgccagcgatgtcctc
gactactcggcggacttcgacacgaagattcaggaccacgacgcagcactagtcgaattc
ttcgctccatggtgcggacactgcaagaggttagcgcccgagtacgaaaaagcagctacc
gaacttaaaaccaacgaccctccagttccattgataaaggtggactgtacctccgacggt
ggaaaagatacgtgttcaaagcatggagtcagcggctaccccaccctcaagatcttcaga
ggtggagagttttcggcggattacaatggcccaagggaagccggtggcatcgttaaatac
atgaaggcccaggtgggaccaagctcgaaggaacttctgtctgttgctgaagtcgagaag
tatctgtcgaaggacgacgttgtcatttttggtttcttcgagagcaaggatgccagcctg
cacgaaaacttcctcaaggttgcagacaagcagcgggaggcctggactttcgggcactcg
tttgacaaggatgtgctcaagaagtatggctacaaaaaccaagttgtgctgttccgaccc
aagattctcaagaacaagtttgaggagagctttgcagtttactctggctctgatgacaag
acggaactggagacattcatcaaggagaactaccatggcctggtgggccacaggactcag
gacaactataacatgttccaggctccgctcctggttgcctactacgacgtagactacacc
aagaacgccaagggcaccaactactggcgcaaccgcatcctcaaggtggcccagaactac
aagggcaagctcaattttgctgtgagcaacaaggacagctttgctgccgagatggacgac
tacggcgtgacggtcaaggccaacaagcctgccatcgccgtgcgcaacagcgagaacgag
aagttccgcatgaccaacgacttcagcgtcgagaacctggagaagttcctggaggagtac
cttgctggcaaagtgaaggcccacctaaagtccgagcccgtgccggagaccaacgacgga
ccggtcaaggtcgcggtggccgagaacttcaagtccctggtcacggagagcaccaaggac
gtcctcatcgagttctatgccccctggtgtggacactgcaagaagttggcccctacttac
gaggaagttggcaagacgcttgctgacgaggatgtcctagttgtgaagatggatgccaca
gccaatgatgtgccgtctgcctttgaggtgtctggtttccccaccctgtactggctgccc
aagaacgacaagcagaacccgcggcggtacgaaggaggccgggagcacgacgacttcatc
aaatggattgccaagcacgccacggacgagctcaaggcctacgaccgctccggagccaag
agggccaaggaggagttatga

DBGET integrated database retrieval system