KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW016161Help
Entry
IscW_ISCW016161   CDS       T01131                                 

Definition
protein disulfide isomerase, putative (EC:2.4.1.119)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    IscW_ISCW016161
Enzymes [BR:isc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     IscW_ISCW016161
Exosome [BR:isc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   IscW_ISCW016161
  Exosomal proteins of colorectal cancer cells
   IscW_ISCW016161
  Exosomal proteins of bladder cancer cells
   IscW_ISCW016161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 486 aa AA seqDB search
MRWFPLLAVLIPAALASDVLDYSADFDTKIQDHDAALVEFFAPWCGHCKRLAPEYEKAAT
ELKTNDPPVPLIKVDCTSDGGKDTCSKHGVSGYPTLKIFRGGEFSADYNGPREAGGIVKY
MKAQVGPSSKELLSVAEVEKYLSKDDVVIFGFFESKDASLHENFLKVADKQREAWTFGHS
FDKDVLKKYGYKNQVVLFRPKILKNKFEESFAVYSGSDDKTELETFIKENYHGLVGHRTQ
DNYNMFQAPLLVAYYDVDYTKNAKGTNYWRNRILKVAQNYKGKLNFAVSNKDSFAAEMDD
YGVTVKANKPAIAVRNSENEKFRMTNDFSVENLEKFLEEYLAGKVKAHLKSEPVPETNDG
PVKVAVAENFKSLVTESTKDVLIEFYAPWCGHCKKLAPTYEEVGKTLADEDVLVVKMDAT
ANDVPSAFEVSGFPTLYWLPKNDKQNPRRYEGGREHDDFIKWIAKHATDELKAYDRSGAK
RAKEEL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggtttcccttgctagcggttttaatccccgctgcgcttgccagcgatgtcctc
gactactcggcggacttcgacacgaagattcaggaccacgacgcagcactagtcgaattc
ttcgctccatggtgcggacactgcaagaggttagcgcccgagtacgaaaaagcagctacc
gaacttaaaaccaacgaccctccagttccattgataaaggtggactgtacctccgacggt
ggaaaagatacgtgttcaaagcatggagtcagcggctaccccaccctcaagatcttcaga
ggtggagagttttcggcggattacaatggcccaagggaagccggtggcatcgttaaatac
atgaaggcccaggtgggaccaagctcgaaggaacttctgtctgttgctgaagtcgagaag
tatctgtcgaaggacgacgttgtcatttttggtttcttcgagagcaaggatgccagcctg
cacgaaaacttcctcaaggttgcagacaagcagcgggaggcctggactttcgggcactcg
tttgacaaggatgtgctcaagaagtatggctacaaaaaccaagttgtgctgttccgaccc
aagattctcaagaacaagtttgaggagagctttgcagtttactctggctctgatgacaag
acggaactggagacattcatcaaggagaactaccatggcctggtgggccacaggactcag
gacaactataacatgttccaggctccgctcctggttgcctactacgacgtagactacacc
aagaacgccaagggcaccaactactggcgcaaccgcatcctcaaggtggcccagaactac
aagggcaagctcaattttgctgtgagcaacaaggacagctttgctgccgagatggacgac
tacggcgtgacggtcaaggccaacaagcctgccatcgccgtgcgcaacagcgagaacgag
aagttccgcatgaccaacgacttcagcgtcgagaacctggagaagttcctggaggagtac
cttgctggcaaagtgaaggcccacctaaagtccgagcccgtgccggagaccaacgacgga
ccggtcaaggtcgcggtggccgagaacttcaagtccctggtcacggagagcaccaaggac
gtcctcatcgagttctatgccccctggtgtggacactgcaagaagttggcccctacttac
gaggaagttggcaagacgcttgctgacgaggatgtcctagttgtgaagatggatgccaca
gccaatgatgtgccgtctgcctttgaggtgtctggtttccccaccctgtactggctgccc
aagaacgacaagcagaacccgcggcggtacgaaggaggccgggagcacgacgacttcatc
aaatggattgccaagcacgccacggacgagctcaaggcctacgaccgctccggagccaag
agggccaaggaggagttatga

  All links  
No link information was found.   
DBGET integrated database retrieval system