KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW016542Help
Entry
IscW_ISCW016542   CDS       T01131                                 

Definition
glutamate receptor, putative
Organism
isc  Ixodes scapularis (black-legged tick)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 725 aa AA seqDB search
LLKLQQIFHMTSNKKLDVRVVRRFMNVSDANAFLHEMELDDRESRKYVVLDSSAEVAKEI
IINHVRDLYTGRRNFHFLLTSLYFNNQILELGVINVTGFRMLQSNRDEFKIFHKSWEKLD
HSKWPGAGTAYVSADVALMHDATKVILDAYSRLLKNKSDIFRNNFRRGEVYNRGTKGIDC
QSWPAVTWEHGKVIADYMKQTQIKGLTGNISFDSQGYRVNFSIDVVEMTINSEMVKIADW
TDTRGLSSHPPKYKRVKQDNEFENKTYIVTSILEEPYLMFKKPEPGQVLVGNDQFEGYCK
DLADLVAEHIRITYVLKLVNDSKYGGRDVNSPAGWNGMVGELIRQEADMAIAPLTITSAR
ERVIDFTKPFMSLGISIMIKKPMKMKPGVFSFMNPLSREIWMCIIFAYVGVSVVLFLVSR
FSPHEWRYEETFVGPSVSNDFSLYNSLWFSLGAFMQQGCDICPRSVAGRIVGSVWWFFTL
IIISSYTANLAAFLTVERMVTPINSADDLAKQTEVEYGTLSFSSTQEFFRRSKIAVYARM
WEFMNTRKHVFTSTYEEGIRRVRESKGKYAFLMESTKNDYINERHPCDTMKVGRNLDAKG
YGVATPLGSNLRDRLNLAVLSMKENGDLARLENKWWYDRSECRSGDSKESTQNELTLSNV
AGCFYILIGGLVLAMVVALLEFCYKSRMEAARSKMTMYEAMKAKVRMSITGTQNGDRGRV
RQGSL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
ttgctgaagttgcaacaaatcttccacatgacgtcgaacaagaagctggacgtgcgggtc
gtgcggcgcttcatgaacgtgtcggacgccaacgcattcctgcacgaaatggagctggac
gacagggagtcccgcaagtacgtggtgctcgacagcagcgccgaggtggccaaggagatc
atcatcaaccacgtccgggacctgtacaccggacgacgcaacttccacttccttctcaca
agcctctacttcaacaaccaaatcctcgaactcggcgtcatcaacgtcaccggattccgg
atgctgcaatcaaatcgagacgagttcaagatctttcacaagtcgtgggaaaagctggac
cacagcaaatggcccggcgcgggaacggcatacgtttcggcggacgtggccttgatgcac
gacgccacaaaagtcatcctggacgcgtactctcggcttctcaagaacaagtcggacatc
ttccggaacaacttcaggcggggggaggtctacaaccgaggcacaaaaggcatcgactgc
cagagctggcccgccgtcacgtgggagcacggcaaggtcatcgccgactacatgaaacag
acacagataaaaggcctcacgggaaacatatcatttgacagccagggataccgagtcaat
ttttctattgacgtcgtggagatgacaattaacagcgagatggttaagatcgcagactgg
acggacactcgtggacttagctcacatcccccaaagtacaaacgggtcaaacaagacaac
gaatttgaaaacaagacgtatattgtaaccagcatattggaggagccttacctgatgttc
aagaagcccgaaccggggcaggtcttggtcggcaacgaccagtttgaagggtactgtaaa
gaccttgcggatcttgtcgcggagcacatacgcatcacctacgttctcaagttggtcaac
gactcaaaatacggcggacgcgatgtcaattctccggcgggctggaacggcatggtggga
gaactcatccgccaggaagctgacatggcaatcgctccgttgaccatcacctccgcccga
gaacgcgtgatcgatttcaccaaacccttcatgtccctgggcatcagcatcatgatcaag
aagccgatgaagatgaaacctggcgtgttctccttcatgaacccgctgtcccgcgagatc
tggatgtgcatcatcttcgcctacgtgggcgtctcggtggtcctgttcctcgtgagccga
ttctcgccacacgagtggcgctacgaggagaccttcgtgggaccgtccgtgtcaaacgac
ttctcgctctacaacagtctctggttctcccttggagccttcatgcaacagggatgcgac
atctgccccaggtcggtagctggtcgcatcgttggcagtgtctggtggttcttcacgctg
ataatcatttcaagctacaccgccaacttggctgcatttttgactgtcgagcgcatggtc
acgccgatcaactcagccgacgacctcgccaagcagaccgaggtcgagtacggtacactc
tccttctcctcgacccaagagtttttcaggcgatctaaaattgccgtctacgcccggatg
tgggagttcatgaacacgcggaagcacgtgttcacctcgacgtacgaagaaggcatccga
cgggtacgcgagtccaagggcaagtacgccttcctcatggagtccaccaagaacgactac
atcaacgagaggcatccctgcgacaccatgaaggtcgggaggaacctggatgccaaggga
tacggagtcgccaccccccttggctcgaacctcagggatcggctgaacttggccgttctt
tctatgaaggagaacggtgaccttgctcgactggaaaacaagtggtggtacgaccgcagc
gaatgcagaagcggagacagcaaagaatccacccagaacgagttgacactcagcaacgtg
gctggctgcttctacatcctaataggcggcctagtgctggcgatggtcgttgccctgcta
gaattctgctacaagtctcgcatggaagcggcgcgttcaaagatgacaatgtacgaggct
atgaaggccaaagtacgcatgtccatcacaggaactcaaaatggcgatcgtggaagggta
cggcaaggctctctctag

DBGET integrated database retrieval system