KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW016542Help
Entry
IscW_ISCW016542   CDS       T01131                                 

Definition
(RefSeq) glutamate receptor, putative
  KO
K05313  glutamate receptor, ionotropic, invertebrate
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Ion channels [BR:isc04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   IscW_ISCW016542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lig_chan Lig_chan-Glu_bd ANF_receptor SBP_bac_3
Motif
Other DBs
NCBI-GeneID: 8025451
NCBI-ProteinID: XP_002409162
VectorBase: ISCW016542
UniProt: B7P6R4
AA seq 725 aa AA seqDB search
LLKLQQIFHMTSNKKLDVRVVRRFMNVSDANAFLHEMELDDRESRKYVVLDSSAEVAKEI
IINHVRDLYTGRRNFHFLLTSLYFNNQILELGVINVTGFRMLQSNRDEFKIFHKSWEKLD
HSKWPGAGTAYVSADVALMHDATKVILDAYSRLLKNKSDIFRNNFRRGEVYNRGTKGIDC
QSWPAVTWEHGKVIADYMKQTQIKGLTGNISFDSQGYRVNFSIDVVEMTINSEMVKIADW
TDTRGLSSHPPKYKRVKQDNEFENKTYIVTSILEEPYLMFKKPEPGQVLVGNDQFEGYCK
DLADLVAEHIRITYVLKLVNDSKYGGRDVNSPAGWNGMVGELIRQEADMAIAPLTITSAR
ERVIDFTKPFMSLGISIMIKKPMKMKPGVFSFMNPLSREIWMCIIFAYVGVSVVLFLVSR
FSPHEWRYEETFVGPSVSNDFSLYNSLWFSLGAFMQQGCDICPRSVAGRIVGSVWWFFTL
IIISSYTANLAAFLTVERMVTPINSADDLAKQTEVEYGTLSFSSTQEFFRRSKIAVYARM
WEFMNTRKHVFTSTYEEGIRRVRESKGKYAFLMESTKNDYINERHPCDTMKVGRNLDAKG
YGVATPLGSNLRDRLNLAVLSMKENGDLARLENKWWYDRSECRSGDSKESTQNELTLSNV
AGCFYILIGGLVLAMVVALLEFCYKSRMEAARSKMTMYEAMKAKVRMSITGTQNGDRGRV
RQGSL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
ttgctgaagttgcaacaaatcttccacatgacgtcgaacaagaagctggacgtgcgggtc
gtgcggcgcttcatgaacgtgtcggacgccaacgcattcctgcacgaaatggagctggac
gacagggagtcccgcaagtacgtggtgctcgacagcagcgccgaggtggccaaggagatc
atcatcaaccacgtccgggacctgtacaccggacgacgcaacttccacttccttctcaca
agcctctacttcaacaaccaaatcctcgaactcggcgtcatcaacgtcaccggattccgg
atgctgcaatcaaatcgagacgagttcaagatctttcacaagtcgtgggaaaagctggac
cacagcaaatggcccggcgcgggaacggcatacgtttcggcggacgtggccttgatgcac
gacgccacaaaagtcatcctggacgcgtactctcggcttctcaagaacaagtcggacatc
ttccggaacaacttcaggcggggggaggtctacaaccgaggcacaaaaggcatcgactgc
cagagctggcccgccgtcacgtgggagcacggcaaggtcatcgccgactacatgaaacag
acacagataaaaggcctcacgggaaacatatcatttgacagccagggataccgagtcaat
ttttctattgacgtcgtggagatgacaattaacagcgagatggttaagatcgcagactgg
acggacactcgtggacttagctcacatcccccaaagtacaaacgggtcaaacaagacaac
gaatttgaaaacaagacgtatattgtaaccagcatattggaggagccttacctgatgttc
aagaagcccgaaccggggcaggtcttggtcggcaacgaccagtttgaagggtactgtaaa
gaccttgcggatcttgtcgcggagcacatacgcatcacctacgttctcaagttggtcaac
gactcaaaatacggcggacgcgatgtcaattctccggcgggctggaacggcatggtggga
gaactcatccgccaggaagctgacatggcaatcgctccgttgaccatcacctccgcccga
gaacgcgtgatcgatttcaccaaacccttcatgtccctgggcatcagcatcatgatcaag
aagccgatgaagatgaaacctggcgtgttctccttcatgaacccgctgtcccgcgagatc
tggatgtgcatcatcttcgcctacgtgggcgtctcggtggtcctgttcctcgtgagccga
ttctcgccacacgagtggcgctacgaggagaccttcgtgggaccgtccgtgtcaaacgac
ttctcgctctacaacagtctctggttctcccttggagccttcatgcaacagggatgcgac
atctgccccaggtcggtagctggtcgcatcgttggcagtgtctggtggttcttcacgctg
ataatcatttcaagctacaccgccaacttggctgcatttttgactgtcgagcgcatggtc
acgccgatcaactcagccgacgacctcgccaagcagaccgaggtcgagtacggtacactc
tccttctcctcgacccaagagtttttcaggcgatctaaaattgccgtctacgcccggatg
tgggagttcatgaacacgcggaagcacgtgttcacctcgacgtacgaagaaggcatccga
cgggtacgcgagtccaagggcaagtacgccttcctcatggagtccaccaagaacgactac
atcaacgagaggcatccctgcgacaccatgaaggtcgggaggaacctggatgccaaggga
tacggagtcgccaccccccttggctcgaacctcagggatcggctgaacttggccgttctt
tctatgaaggagaacggtgaccttgctcgactggaaaacaagtggtggtacgaccgcagc
gaatgcagaagcggagacagcaaagaatccacccagaacgagttgacactcagcaacgtg
gctggctgcttctacatcctaataggcggcctagtgctggcgatggtcgttgccctgcta
gaattctgctacaagtctcgcatggaagcggcgcgttcaaagatgacaatgtacgaggct
atgaaggccaaagtacgcatgtccatcacaggaactcaaaatggcgatcgtggaagggta
cggcaaggctctctctag

DBGET integrated database retrieval system