KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW016681Help
Entry
IscW_ISCW016681   CDS       T01131                                 

Definition
acetyl-coenzyme A synthetase, cytoplasmic, putative (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:isc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:isc00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:isc00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:isc00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 547 aa AA seqDB search
EGNNPKDRKTITYEELLNDVCKFANVLKGKGVCQGHLVTIYLPMVPELIVAMLACARLGA
VHTVVFAGYSAESLAQRMFDTQSRILVTADGCWRGKKLILLKPIADEAIAICAKKGHAVE
SCIVLRHLMSSETRCGGTLLNGVSKDFLEIDTTTDSIYSWWHDEMQVQSTDCDVVWVDSE
EPLFLLYTSGSTGRPKGVIHTTGGYLLYSLATVYYTFDYRPEDIFFCSADVGWVTGHTHV
VYGVLANGATSVLFEGIPFYPDPGRFWEVIDHYQVTKFYTAPTAIRALMKYGDAFVKKHS
RKSLKLLGIAGEPIGPDAWFWYHHVVGECRCTVLDTYWQTETGGQMITPLPGCTPLKPGA
ATLPFFGVMPAILDKDGNEIKGPGEGYLVRLTSAGARRDEDGYYWITGRVDDMLNVSGHL
ISTAQIESALLAIPDLSEAAAVPRPHKVKGQCLYCYVVLKEGKTFTEDLKTRLKQSVRSK
IGAFADPEYIHSVERLPKTRSGKVMRRILRKIACNELEFGDVSALSEQDVISELLQSKCF
IQNKNNR
NT seq 1645 nt NT seq  +upstreamnt  +downstreamnt
ggagggcaacaaccccaaagaccgaaagaccatcacatatgaggagctgttgaacgatgt
ctgcaagttcgccaacgtgctcaaaggaaaaggtgtctgccagggacacttagtcaccat
ttatctgcccatggtgcccgagctaatcgtcgcaatgctggcatgtgcaaggcttggggc
agttcacactgtcgttttcgctggttactcggccgagtccttagcccaacggatgttcga
cacgcagtcaaggatactggtcaccgctgatggatgctggagaggaaagaagctcattct
gctgaaacccatcgcggatgaggccattgcgatttgcgccaaaaagggtcatgcggtgga
gtcttgcatcgttcttcgtcatctcatgtcaagcgagacccggtgtggaggcactctgct
caatggggtatcgaaagacttcctagaaatcgacacgaccacggacagcatctacagctg
gtggcacgacgagatgcaggttcagtccacagactgcgacgtcgtctgggtagattccga
agaaccgctctttctactgtacacgagcggttccacgggacgacccaaaggcgtcatcca
caccacgggaggatatctgctgtactctctggccaccgtgtactacaccttcgactaccg
gccagaggacatcttcttctgctcggctgacgtgggctgggttacaggacacacgcacgt
cgtctatggcgtcttagccaatggagccaccagcgtcctgtttgaaggtattccttttta
ccctgatcccggtcgcttttgggaggttatcgaccactaccaggtgaccaaattctacac
ggcgccaacggcgatacgggctcttatgaagtacggtgatgccttcgtgaagaagcacag
ccgcaagtccctgaagctccttggaatcgccggcgagccgatcggccccgacgcttggtt
ctggtaccaccacgtcgtcggagagtgccgctgcacagtcctcgacacctactggcaaac
cgagacaggtggccagatgatcacccctctgcccgggtgcacgccgctgaagccaggagc
agctacgctgcccttctttggcgtgatgcccgccatacttgacaaggatggcaacgaaat
caagggacccggagaaggatacctggtacggcttacctctgcaggagccaggcgagacga
ggacggctactactggatcactggtcgtgtggacgacatgctgaacgtttcgggtcacct
gatttcgacggcccagatcgagtcggcacttctcgccattcccgacctttccgaagccgc
cgcagtgcctcgaccccacaaggtcaaggggcagtgcctctactgctacgtcgttctcaa
ggagggcaagacattcactgaggacctgaagacacggctcaagcaaagcgtgaggtccaa
gatcggcgccttcgccgaccccgaatacattcacagtgtggagcgactcccgaagaccag
gtccggcaaagtgatgcgtcggatcctccgcaagatcgcctgcaacgagctcgagtttgg
cgacgtgagcgccctcagcgaacaagacgtcatctccgaactcctgcagtccaagtgctt
catccagaacaaaaacaatcgctag

DBGET integrated database retrieval system