KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW016681Help
Entry
IscW_ISCW016681   CDS       T01131                                 

Definition
acetyl-coenzyme A synthetase, cytoplasmic, putative (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    IscW_ISCW016681
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IscW_ISCW016681
   00620 Pyruvate metabolism
    IscW_ISCW016681
   00640 Propanoate metabolism
    IscW_ISCW016681
Enzymes [BR:isc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     IscW_ISCW016681
Lipid biosynthesis proteins [BR:isc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   IscW_ISCW016681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 547 aa AA seqDB search
EGNNPKDRKTITYEELLNDVCKFANVLKGKGVCQGHLVTIYLPMVPELIVAMLACARLGA
VHTVVFAGYSAESLAQRMFDTQSRILVTADGCWRGKKLILLKPIADEAIAICAKKGHAVE
SCIVLRHLMSSETRCGGTLLNGVSKDFLEIDTTTDSIYSWWHDEMQVQSTDCDVVWVDSE
EPLFLLYTSGSTGRPKGVIHTTGGYLLYSLATVYYTFDYRPEDIFFCSADVGWVTGHTHV
VYGVLANGATSVLFEGIPFYPDPGRFWEVIDHYQVTKFYTAPTAIRALMKYGDAFVKKHS
RKSLKLLGIAGEPIGPDAWFWYHHVVGECRCTVLDTYWQTETGGQMITPLPGCTPLKPGA
ATLPFFGVMPAILDKDGNEIKGPGEGYLVRLTSAGARRDEDGYYWITGRVDDMLNVSGHL
ISTAQIESALLAIPDLSEAAAVPRPHKVKGQCLYCYVVLKEGKTFTEDLKTRLKQSVRSK
IGAFADPEYIHSVERLPKTRSGKVMRRILRKIACNELEFGDVSALSEQDVISELLQSKCF
IQNKNNR
NT seq 1645 nt NT seq  +upstreamnt  +downstreamnt
ggagggcaacaaccccaaagaccgaaagaccatcacatatgaggagctgttgaacgatgt
ctgcaagttcgccaacgtgctcaaaggaaaaggtgtctgccagggacacttagtcaccat
ttatctgcccatggtgcccgagctaatcgtcgcaatgctggcatgtgcaaggcttggggc
agttcacactgtcgttttcgctggttactcggccgagtccttagcccaacggatgttcga
cacgcagtcaaggatactggtcaccgctgatggatgctggagaggaaagaagctcattct
gctgaaacccatcgcggatgaggccattgcgatttgcgccaaaaagggtcatgcggtgga
gtcttgcatcgttcttcgtcatctcatgtcaagcgagacccggtgtggaggcactctgct
caatggggtatcgaaagacttcctagaaatcgacacgaccacggacagcatctacagctg
gtggcacgacgagatgcaggttcagtccacagactgcgacgtcgtctgggtagattccga
agaaccgctctttctactgtacacgagcggttccacgggacgacccaaaggcgtcatcca
caccacgggaggatatctgctgtactctctggccaccgtgtactacaccttcgactaccg
gccagaggacatcttcttctgctcggctgacgtgggctgggttacaggacacacgcacgt
cgtctatggcgtcttagccaatggagccaccagcgtcctgtttgaaggtattccttttta
ccctgatcccggtcgcttttgggaggttatcgaccactaccaggtgaccaaattctacac
ggcgccaacggcgatacgggctcttatgaagtacggtgatgccttcgtgaagaagcacag
ccgcaagtccctgaagctccttggaatcgccggcgagccgatcggccccgacgcttggtt
ctggtaccaccacgtcgtcggagagtgccgctgcacagtcctcgacacctactggcaaac
cgagacaggtggccagatgatcacccctctgcccgggtgcacgccgctgaagccaggagc
agctacgctgcccttctttggcgtgatgcccgccatacttgacaaggatggcaacgaaat
caagggacccggagaaggatacctggtacggcttacctctgcaggagccaggcgagacga
ggacggctactactggatcactggtcgtgtggacgacatgctgaacgtttcgggtcacct
gatttcgacggcccagatcgagtcggcacttctcgccattcccgacctttccgaagccgc
cgcagtgcctcgaccccacaaggtcaaggggcagtgcctctactgctacgtcgttctcaa
ggagggcaagacattcactgaggacctgaagacacggctcaagcaaagcgtgaggtccaa
gatcggcgccttcgccgaccccgaatacattcacagtgtggagcgactcccgaagaccag
gtccggcaaagtgatgcgtcggatcctccgcaagatcgcctgcaacgagctcgagtttgg
cgacgtgagcgccctcagcgaacaagacgtcatctccgaactcctgcagtccaagtgctt
catccagaacaaaaacaatcgctag

DBGET integrated database retrieval system