KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW016705Help
Entry
IscW_ISCW016705   CDS       T01131                                 

Definition
(RefSeq) lysophospholipase, putative
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    IscW_ISCW016705
Enzymes [BR:isc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     IscW_ISCW016705
Peptidases [BR:isc01002]
 Serine Peptidases
  Family S33
   IscW_ISCW016705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
VectorBase: 
UniProt: 
AA seq 269 aa AA seqDB search
MTKIWRCRALVFLAHGYAEHSGVPCYETLAMALVGLGCHVFAHDHVGHGKSEGPRAIVDS
VDTYVQDLFTHLDTVRQRYPGKPVYLFGHSMGGLLVAAAALKRPKDYAGVVMMAPLLAMD
KEQATWFRTTMARFLGRIVPNLPISSLDLSLVSKDPAVVNWMTQDPLRYHGLVRVGWAAA
ILKALEEVQSKMETFEVPFLIQHGSADKLCDLGGSELFFKKALSKDKTIKVYNDSYHNLL
MEPDGVGDQVLKDIAEWYATRVPEVSQQA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagatatggcgctgcagggcgctggtattcctggcccacgggtatgcggagcac
agcggcgtcccctgctacgagaccctggccatggccctggtgggcctgggctgccacgtc
ttcgctcacgaccacgtgggccacggcaaaagcgagggtcctcgagccatagtggactct
gtggacacgtacgtgcaggacctcttcacccatctggacacggtccgccagaggtatccc
ggaaaacccgtctacctcttcggacactccatgggaggattgcttgtcgcagcggcggct
ctgaagaggcccaaagattacgccggcgtcgtgatgatggcgcctcttttggccatggac
aaggagcaggccacgtggtttaggacaaccatggccaggtttttggggaggatcgtgccc
aaccttcccatttcatcgctggatctcagtctggtgtccaaggaccctgcggtggtcaac
tggatgactcaagacccgctccgttatcacggccttgtgcgggtcggctgggcggccgcc
atattaaaggcgttagaggaagtccagtccaagatggagacattcgaggtgcccttcctg
attcaacatggctcagccgacaagctctgcgacctggggggctccgagttattcttcaag
aaggcgctcagcaaggacaagaccatcaaagtgtacaacgacagctaccacaacctgctc
atggaacccgacggtgtcggagaccaagtgctcaaggacatcgcggagtggtacgccacc
agggtacccgaggtatcgcagcaggcgtag

DBGET integrated database retrieval system