KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW016807Help
Entry
IscW_ISCW016807   CDS       T01131                                 

Definition
core 1 UDP-galactose:N-acetylgalactosamine-alpha-r beta 1,3- galactosyltransferase, putative (EC:2.4.1.175)
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    IscW_ISCW016807
Enzymes [BR:isc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     IscW_ISCW016807
Glycosyltransferases [BR:isc01003]
 Glycan extension
  Type 3 chain
   IscW_ISCW016807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 301 aa AA seqDB search
HAGEDMLANQLSRKVRVLCWVMTQPKNHAKKARHVKATWGQRCNTLLFMSSAPEPSLPTV
VLPIKESRNTLWAKTKAAFQEVYKNHLNSSDWFLKADDDTYVVLENLRYLLKDKSPSDPV
YYGRRFKPYVEQGYMSGGAGYVLSREAVRRLVEDGLSHPNKCRSDGGGSEDVEIGKCLEK
VGVKAGDSRDLQGRGRFFPLAPDFHLVSGKRKDFWYWKYIYYPSKEGLECCSDTAISFHY
ISPGMMYVMEYLIYHLRPYGIDHIVHQHPEMFNDLRPAVNNPKPKEVTSEQNKGSTRTIK
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
cacgcaggcgaggatatgctggccaatcaacttagtcgaaaggtacgggtgctctgctgg
gtgatgacgcagcctaaaaaccacgcgaagaaggcccgccatgtcaaggccacctggggt
cagcgctgtaacactctcctcttcatgagcagtgccccagaacccagcctgccaactgtg
gtgcttccgataaaggaatcccgaaataccctgtgggctaaaacgaaggcggcgttccag
gaggtctacaagaatcatctcaattcgtccgattggttcctgaaggccgacgacgatacc
tacgttgtcctggaaaacctaagatatctcctgaaggacaaaagcccatccgatcctgtg
tactacggacgtcgcttcaagccttacgtggaacaaggctacatgagtggcggtgcaggc
tacgtgctcagcagagaagccgtgcgtcgtttggtcgaagatggactgagtcatccgaac
aagtgtcgctccgatgggggaggttcagaggacgtggagatcgggaagtgtttggagaag
gtcggtgtcaaggcgggggactcgagggaccttcaaggtcgagggcgcttctttccgctc
gctcccgacttccacttggtatcgggaaagcgaaaggacttctggtactggaagtacatc
tactacccgtctaaagagggtctggagtgctgcagcgatacagccatctcattccactac
atcagccccggcatgatgtatgttatggagtacttaatatatcatctgaggccatatgga
attgaccatattgtccaccaacatccggaaatgtttaatgatctgcgaccagcggtcaac
aatcccaagccaaaggaagtgaccagtgaacaaaataaagggtcgacgagaactataaaa
ttataa

DBGET integrated database retrieval system