KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW016926Help
Entry
IscW_ISCW016926   CDS       T01131                                 

Definition
protein kinase, putative (EC:2.7.11.23)
Orthology
K02091  
cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     IscW_ISCW016926
Protein kinases [BR:isc01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   IscW_ISCW016926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 316 aa AA seqDB search
MAATDQAMSFLLGDVSSENPYEEVAHIGTGAFGTVYKARDRHNDGRMVALKKVRVPLSEE
GIPTAMLREISFLRQLDAAQHPNVVRLLDICHGCRMERELVVFLVFEHIDQDLAGFLDRC
PEPGLEPSLLLWLLKQLLTGVEFLHSHRIVHRDLKPQNVLVTAQWQLKLADFGLARLYER
HMSLTPVVVTLWYRPPEVLLQASYGPPVDLWSCGCILAEMARRKPLFGGRSEGEQLARIL
ELLGLPSEDEWPPEAAVSRSSFGRGRISDEALKDAVPQLDALTLDLLRQMLRFGPDRRVT
AKAALTHPCLIGVSAP
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaacagaccaagccatgtccttcctgctcggcgacgtgtccagcgaaaatcca
tacgaagaagtggctcacattggcacgggcgcattcggcacagtgtacaaggcacgcgac
cgtcacaatgatggacgcatggtggccctgaagaaagtgcgcgtacccctcagtgaggaa
ggcatcccaacagccatgcttcgtgagatcagcttcttacgccagctggatgccgctcag
cacccaaacgttgtgcgcctcctcgatatctgccacggttgtaggatggagcgcgagctc
gtcgtcttcctggtcttcgagcacattgaccaagacctcgccggcttcctggatagatgt
cctgaacctggcctggagccctctttgctcctgtggcttctcaagcagctgcttacagga
gtggagttcctgcattcgcatcgcattgtgcatcgcgacctcaagcctcagaacgttctg
gtgacggcgcagtggcagctgaagctggccgacttcgggctggcccggttgtatgagcgt
cacatgtcgttgacccctgttgtggtcacgctgtggtaccggcccccggaagtacttcta
caggccagctacggtcctccggtggacctctggagctgcggatgcatcctggccgagatg
gcacgacgcaagccgctgtttggaggtcgctcggaaggggagcagttggctcggatctta
gagctcttgggtctgccatctgaagatgagtggcctcctgaggcagctgtttcccggagc
tcctttggaagggggaggatttctgatgaagccctgaaggacgcggtgccacaactagat
gccctcaccctggacctcttacgacaaatgcttcgctttgggccggaccggcgcgtcaca
gcaaaggctgccttgacacatccgtgtctgatcggggtctctgcaccctga

DBGET integrated database retrieval system