KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW017142Help
Entry
IscW_ISCW017142   CDS       T01131                                 

Definition
transforming acidic coiled-coil containing protein, putative
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    IscW_ISCW017142
Messenger RNA biogenesis [BR:isc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     IscW_ISCW017142
   mRNA cycle factors
    P-body specific factors
     IscW_ISCW017142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 238 aa AA seqDB search
MFSEKEMTQALKYQELMFQERLLKKDQDYMKEQDKLREEAEAWRAKFEHLGGLYEQQENT
MMMLKRQVLAANARHNEQIVSAIERHVLGKKKDTDEKTASLQKITKERDQLAGDLHNMEI
AFADFHRRYEKAKQAISTLKENESILKQQLADYREGVEKSNQMFNLLKAKTEESLEGASK
EIEDSKKNFQADITVLRGQLKKAEMDNSCLEKRLEQKTEENAQLAKLYDDLLSQVKAK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgttctctgagaaggagatgacgcaggcgctcaaatatcaggaactgatgttccaagag
cgcctgctcaagaaggaccaggactatatgaaagaacaggacaagctgcgagaggaggcc
gaggcttggcgggcaaagttcgaacacttgggtggcctatatgagcagcaggagaacact
atgatgatgctcaagaggcaagttctggctgccaatgctcgccacaatgagcagatcgtg
tctgccatagagcgccacgtactcggcaagaaaaaggacacagacgagaagaccgcttcg
ctccagaagataactaaagagcgtgatcagttggcgggggacttgcacaacatggaaatc
gcttttgcggacttccaccgacgctacgagaaggccaagcaagcaatctctacgttgaaa
gagaacgagtccatcctgaagcagcaactggccgactaccgggaaggagttgagaaaagc
aaccagatgttcaacctgctcaaagccaagacggaggagagtcttgaaggggctagcaaa
gagattgaggactctaagaagaatttccaagcagacatcactgtcttgagaggccagttg
aagaaagcagagatggacaacagctgtctggagaagcggcttgaacaaaagactgaggaa
aatgctcagctggcaaagctgtacgacgacctgctcagccaagtgaaagcaaagtag

DBGET integrated database retrieval system