KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW017172Help
Entry
IscW_ISCW017172   CDS       T01131                                 

Definition
guanylate kinase, putative (EC:2.7.4.8)
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
isc  Ixodes scapularis (black-legged tick)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 444 aa AA seqDB search
SEDSIKIVHIDKTNEPLGATVRNEGESVIIGRIVKGGAAEKSGLLHEGDEVLEVNGIGMR
GKSVNEVCDLLATMTGTLTFLIVPCGHEVIAPRSTDTGMIHAHFDYEPEEDPYIPCRELG
IPFQKGDVLHVINRDDPNWWQAYRQGEEDQTLAGLIPSKSFQQQREAMKQALAGGDAATK
EKTKRGRGSLAAFASTTFWRAPCSFPSCAEPETGEPVPTYEEVSLFYPRPNCKRPVVLVG
PSNIGRHELRQKLMEDTERFAAAVPLKMLQTRAVPQDSELDGLDYHFISRPQFEADILAG
KFVEHGEYERNYYGTSLGAIRSVVGSGKVCVLNLHPQSLKMLKHSDLKPYVVFVAPPSLE
KLRQHRMRQGVPVREDELRETIERARQMEDSYGHYFDMVIVNSDLDRAYSELLKEVAILE
REPQWVPSAWLTNQDTAPPATAGS
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
tcggaggacagcatcaagatcgtgcacatcgacaaaaccaacgaacccctgggtgcgacg
gtgcgcaacgagggtgaatcggtcatcatcggacggatcgtcaaaggtggtgctgccgag
aagagtgggttgttgcacgagggcgatgaagtgctggaggtgaacggcatcgggatgagg
ggcaaatcggtgaacgaggtgtgcgacctgctggccaccatgacaggcaccctcaccttt
ctcatcgtgccctgcggccacgaggtcattgccccccgaagcacggacacgggcatgatt
cacgcccactttgactacgagcctgaggaggacccgtacatcccatgccgggagctgggc
atcccattccagaagggggacgtcctgcacgtcatcaaccgggacgaccctaactggtgg
caggcctaccgccagggcgaggaggaccagactctggcggggctcatcccctccaagtcc
ttccagcagcagcgcgaagccatgaaacaagcgcttgctggaggagatgcagccacgaag
gaaaaaacgaagcgaggtcgcggcagtttggccgcatttgcgagtacaactttttggcga
gcgccgtgttcgttcccttcgtgcgcagagccggaaaccggggagcccgtgccgacgtac
gaggaggtgtcgctcttctacccgcggcccaattgcaagcgccccgtggtacttgtggga
ccctccaacatcggtcggcacgaactgcggcagaagctcatggaggacacggaaagattc
gcagccgcagtgccactcaaaatgttgcagacacgagccgtcccgcaagactccgagctg
gatgggctggactaccacttcatcagccggccccagttcgaggcggacatcctggccggc
aagtttgtggagcacggggagtacgagcgcaactattacggcaccagccttggcgccatc
cgcagcgtcgtcgggtcgggaaaggtctgcgtgctcaacctgcacccgcagtctctcaag
atgctgaagcactccgacctgaagccgtatgtggtgttcgtggcgccgccatcccttgag
aaactccgccagcaccggatgcgccagggcgtcccagtgcgcgaggacgagctgcgcgag
accattgagcgggcgcgccagatggaagacagctacggacactatttcgacatggtcatc
gtcaactcggacctggaccgagcgtacagcgagctgctcaaggaagtggccatcttggag
agggagccccagtgggtccccagtgcctggctgaccaatcaggacactgcaccgcccgcc
accgcaggatcctag

DBGET integrated database retrieval system