KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW017459Help
Entry
IscW_ISCW017459   CDS       T01131                                 

Definition
glucose-6-phosphatase, putative (EC:3.1.3.9)
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:isc00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:isc00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:isc00500]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:isc04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 356 aa AA seqDB search
MIDITMDRLHDNGMFAIQSLQTRFQHQHGFFFAISNFGDPRYAFLIFAPLIYSLDWTVGR
RLMWVTIIAEWSNQVLKWMLHGERPYWWVHETDVYNRTGAGTPAIKQYSLTCETGPGSPS
GHAMVSAAIWYIIIDFLLRRTGAFEQLSKTMVSSFHWGTYTVLLCVVSLSRIYIAAHFPH
QCLMGMIIGCCLAKLMCKMDTDNVTRRQYVFMSLALCASAMSTYGVLRLMGVDPLWSVDR
AVKWCAKQEYIHVDTTPFFSMMRYCAFPLGMGLAMTSGLYKKVMAVDFSWKMRVVAAVLA
VSAGKASEWVALPKTNVPVFYASAFIFNALLAATMFGVVPFVVASLSGRLGKVKSN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacatcacaatggacagattgcacgacaatggcatgtttgcgatccagtcgtta
caaacaaggtttcaacaccagcacgggtttttcttcgccatctccaactttggggaccct
cgctatgctttcctcatcttcgcgcctctcatctactccctggactggactgtgggccga
cggctgatgtgggtcacaatcatcgcagaatggtctaatcaagtgctcaaatggatgctc
cacggagagcggccgtactggtgggtgcacgagacggacgtgtacaacaggacaggtgct
ggcactcctgccatcaagcagtactctctcacgtgcgagacaggccccggcagtccgtcc
ggtcacgccatggtgtccgccgctatttggtacatcatcatcgacttcctgctgcgtcgc
accggcgccttcgagcagctgagcaagaccatggtctcgtccttccactggggcacctac
accgtgttgctgtgcgttgtcagcctgtcccgaatctacatagcggcccacttccctcac
cagtgcctcatgggcatgataatcggttgctgcttggccaagctgatgtgcaagatggac
acggacaacgtgacgcgccggcagtatgtgttcatgtccctggccttgtgcgccagtgct
atgtccacctacggcgtcctccgcctgatgggtgtcgaccccctctggtccgtcgaccgt
gccgtcaagtggtgcgccaagcaagagtacatccatgtggacaccacgcctttcttcagc
atgatgcgctactgcgccttccctctcggcatgggcctggccatgacctccggcttgtac
aagaaagttatggccgtcgacttctcttggaagatgcgcgtcgtggctgccgttctcgcc
gtcagtgcaggcaaggcctccgagtgggtggctcttccgaagaccaacgtgcctgtcttc
tacgcgtcggcgttcatcttcaacgccctcctggcggccacgatgttcggagtcgtgcca
ttcgtggtcgcgtctttatcggggcgtctcgggaaagttaaatccaactaa

DBGET integrated database retrieval system