KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW017459Help
Entry
IscW_ISCW017459   CDS       T01131                                 

Definition
glucose-6-phosphatase, putative (EC:3.1.3.9)
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IscW_ISCW017459
   00052 Galactose metabolism
    IscW_ISCW017459
   00500 Starch and sucrose metabolism
    IscW_ISCW017459
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    IscW_ISCW017459
Enzymes [BR:isc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     IscW_ISCW017459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 356 aa AA seqDB search
MIDITMDRLHDNGMFAIQSLQTRFQHQHGFFFAISNFGDPRYAFLIFAPLIYSLDWTVGR
RLMWVTIIAEWSNQVLKWMLHGERPYWWVHETDVYNRTGAGTPAIKQYSLTCETGPGSPS
GHAMVSAAIWYIIIDFLLRRTGAFEQLSKTMVSSFHWGTYTVLLCVVSLSRIYIAAHFPH
QCLMGMIIGCCLAKLMCKMDTDNVTRRQYVFMSLALCASAMSTYGVLRLMGVDPLWSVDR
AVKWCAKQEYIHVDTTPFFSMMRYCAFPLGMGLAMTSGLYKKVMAVDFSWKMRVVAAVLA
VSAGKASEWVALPKTNVPVFYASAFIFNALLAATMFGVVPFVVASLSGRLGKVKSN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacatcacaatggacagattgcacgacaatggcatgtttgcgatccagtcgtta
caaacaaggtttcaacaccagcacgggtttttcttcgccatctccaactttggggaccct
cgctatgctttcctcatcttcgcgcctctcatctactccctggactggactgtgggccga
cggctgatgtgggtcacaatcatcgcagaatggtctaatcaagtgctcaaatggatgctc
cacggagagcggccgtactggtgggtgcacgagacggacgtgtacaacaggacaggtgct
ggcactcctgccatcaagcagtactctctcacgtgcgagacaggccccggcagtccgtcc
ggtcacgccatggtgtccgccgctatttggtacatcatcatcgacttcctgctgcgtcgc
accggcgccttcgagcagctgagcaagaccatggtctcgtccttccactggggcacctac
accgtgttgctgtgcgttgtcagcctgtcccgaatctacatagcggcccacttccctcac
cagtgcctcatgggcatgataatcggttgctgcttggccaagctgatgtgcaagatggac
acggacaacgtgacgcgccggcagtatgtgttcatgtccctggccttgtgcgccagtgct
atgtccacctacggcgtcctccgcctgatgggtgtcgaccccctctggtccgtcgaccgt
gccgtcaagtggtgcgccaagcaagagtacatccatgtggacaccacgcctttcttcagc
atgatgcgctactgcgccttccctctcggcatgggcctggccatgacctccggcttgtac
aagaaagttatggccgtcgacttctcttggaagatgcgcgtcgtggctgccgttctcgcc
gtcagtgcaggcaaggcctccgagtgggtggctcttccgaagaccaacgtgcctgtcttc
tacgcgtcggcgttcatcttcaacgccctcctggcggccacgatgttcggagtcgtgcca
ttcgtggtcgcgtctttatcggggcgtctcgggaaagttaaatccaactaa

DBGET integrated database retrieval system