KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW017541Help
Entry
IscW_ISCW017541   CDS       T01131                                 

Definition
Josephin-1, putative
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     IscW_ISCW017541
Peptidases [BR:isc01002]
 Cysteine Peptidases
  Family C86
   IscW_ISCW017541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 203 aa AA seqDB search
MYQSCLRLVDRLLRKDQKPGRPGLAPPVYHERQVKELCALHALNNLFQDASAFSKGSLDD
ICHSLSPDHLVNPHKSVLGLGNYDVNVIMSALQLRGYEAIWFDKRKDPTCIDLSKIVGFI
LNVPSEMKFGFLQFPLSRKHWIAVREVEGTFYNLDSKLEAPSPIGKAPELLQYLREQVKC
KDREIFVVVTQEIGRVKGCYQDA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagtcgtgcctgaggctggtggaccggctcctgcgcaaggaccagaagccaggg
cggccgggcctggccccgccggtctaccacgagcgccaggtgaaggagctgtgcgccctg
cacgccctcaacaacctcttccaggacgcctccgccttctccaagggctccctggacgac
atctgccacagcctgtcccccgaccacctggtgaacccgcacaagagcgtgctgggcctg
ggcaactacgacgtcaacgtcatcatgtccgccctgcagctcagaggatacgaggccatc
tggttcgacaagcgcaaggacccgacctgcattgacctgtccaagattgtggggttcatc
ctgaacgtgccgagcgagatgaagttcggcttcctccagttcccgctgagccgcaagcac
tggatcgccgtgcgcgaggtcgagggcaccttctacaacctcgactccaagctggaggcg
ccctcgcccatcggcaaggcccccgagctgttgcagtacctccgggagcaggtcaagtgc
aaggaccgcgagatcttcgtcgtggtcacgcaggagattgggagggtcaagggctgctac
caggacgcc

DBGET integrated database retrieval system