KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW017614Help
Entry
IscW_ISCW017614   CDS       T01131                                 

Definition
ethanolamine kinase, putative (EC:2.7.1.82)
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    IscW_ISCW017614
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     IscW_ISCW017614
    2.7.1.82  ethanolamine kinase
     IscW_ISCW017614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 376 aa AA seqDB search
MRDKAYNICREFLSGTWKSISSSDMVFKSVSGGLSNLLYYCSLPETHTPLYGEPSQVLMR
MYGQIHSEGGESTVTESVICTLLSERNLGPKLYGVFPGGRLEEYIPARALTIEQLKDPEI
SLLIAKKLGKVHVLQAPLVKEPTWLFNNMQRWLKYARSIKVDSLPVKDYTNAVNLLSVDL
AAEVGWLRELLSTVCSPIVFCHNDLQEGNILFMEGPGPKEDNMVFIDYEYCAYNYRGFDI
GNHFCEWMYDYSYPEHPYFKVLPHDYPRLEHQREFVSHYLRSYKMCQTLKPEDNTPGAIN
TVEHVLKEAHMFTLASHLMWTLWSIFNAHTSKIKFGYWEYGQARLESYLKLKQQLLTAAS
EHQQQVDSEATPAATT
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacaaggcgtacaacatttgccgggagtttttgagcggtacttggaaaagcata
tccagcagcgacatggtcttcaagtctgtgagcggcggcctgagcaacctgctgtactac
tgttcgctgccggagacgcacacgccgctgtacggcgagcccagccaggtgctgatgcgc
atgtacggccagatccacagcgagggcggggagtccaccgtcacggagagcgtcatctgc
accctgctctcggagcgcaacctggggcccaagctgtacggcgtctttcccggcggcagg
ctcgaggagtacatacccgcacgtgctctgaccatcgagcagctcaaggaccctgagatc
tcgctgttgattgccaagaagctgggcaaggtgcatgtgctgcaggcacctctggtcaag
gaacccacgtggctcttcaacaacatgcagaggtggctcaagtatgcgcggagtatcaag
gtggactcgctgccagtcaaggactacacaaacgccgtcaacctcctctcggtcgacctg
gctgcagaagtcggctggctcagggagctcctgtctacagtgtgttctccgatcgtgttc
tgccacaatgacctgcaggaaggaaacattctcttcatggaaggtcctggccccaaagaa
gacaacatggtgttcattgattacgagtactgtgcctacaattaccgggggtttgacatt
gggaaccacttctgcgagtggatgtacgactactcctaccccgagcacccctacttcaag
gtcttgccgcacgactacccccgcctagagcaccagcgggagtttgtgagccactacctg
cggtcgtacaagatgtgccagacgctgaagcccgaggacaacacgccgggagccatcaac
acggtggagcacgtgctcaaggaggcccacatgttcaccctggcctcccacctcatgtgg
accctgtggagcatcttcaacgcccacacctccaagatcaagttcggctactgggaatat
gggcaggctcggctggagagctacctcaagctcaagcagcagctgttaacggcggcgtcg
gagcaccagcagcaggtggactcggaagcgacgccggcggcaacgacatag

DBGET integrated database retrieval system