KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW017704Help
Entry
IscW_ISCW017704   CDS       T01131                                 

Definition
protein-tyrosine phosphatase, putative (EC:2.7.11.14)
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     IscW_ISCW017704
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 440 aa AA seqDB search
IWPLVSCFCISTVCSARLEQTDEVPSVQIVTLTKLEDTRPTVSSGDARQQTAPTPATAQP
RPGVRPAWLLALGVGAVLLLLLAGLCPLLAWWLQRKPLPSKGDPELWLGPPPAGGDTLPL
QCVPTAVQSAGPSPLHRTRGLLERRGSNASLTLDLQRTGNSDKQGSGPYLASRRLTRAQL
RSCLSNVAALHSEFWDIPMNHPERAAVPGCGGKNRYRSILPNEHSRVLLGPRGDYINANR
LRGFKGARSAYIATQGPLPHTVADFWAMVWQERAPVIVMITNLVEDAKVKCEQYLPEGEP
LRFGEIGVAVLRTTPRDGYTLRELALECRGEQRRVAHLWYTAWPDHGTPACPQQLLSLAR
EAEQLRSETGPLVVHCSAGLGRTGCFVASSIGMQQLEAEGSVDVLATVCALRGDRGGMVQ
TAEQYEFVHRTLCLFEQQLP
NT seq 1324 nt NT seq  +upstreamnt  +downstreamnt
catatggccactcgtatcatgcttctgcatctcaactgtgtgctctgccaggctcgagca
gacggacgaagttccctcggtgcagatcgttactctgacaaagctcgaggacaccaggcc
caccgtctcgtcgggagatgcgaggcagcagacggcccctactccggccacggcgcagcc
ccggcccggtgtgcgtccggcctggctactggcccttggggtgggtgccgtgctgctgct
gctgctggctgggctctgccctctgctggcgtggtggttgcagcgcaagccactcccttc
caagggcgaccccgaactgtggctggggcctcctccagccggcggcgacacgcttcccct
gcagtgcgtgcccacggcggtgcagtccgcggggcccagccccctgcacaggacaagggg
tctcctggagaggcggggatccaatgcctccctgaccctggatctccagcgcacgggcaa
ctcggacaagcagggctccgggccgtacctcgcaagccggaggctgactcgagcccagct
gcgctcttgcctgagcaacgtggctgcccttcactcagagttttgggacatcccgatgaa
ccaccccgagcgagcggccgttccgggctgcggcggcaagaaccgctaccggagcatcct
gccgaacgagcacagccgggtgctgctggggccccggggagactacatcaacgccaaccg
gctgcggggcttcaagggggcccgcagtgcctacatcgccacccagggaccccttccgca
cacggtggccgacttctgggccatggtgtggcaggaacgggcgcccgtcatcgtcatgat
caccaatctagtcgaagacgccaaggtgaagtgtgagcaatacctgccagagggagaacc
cctccgcttcggggagataggagtggcggtgctgcggacaacgcctcgggacggctacac
cctgcgggagctggctctagagtgccgtggtgaacaacggcgggtggctcacctgtggta
cacggcctggccggaccacggcacacccgcttgcccccagcagctgctgtccctggccag
ggaagccgagcagctgcgctcagaaaccgggcctctcgtcgtccactgcagtgcgggact
aggccgcacgggctgctttgtggccagcagcatcggcatgcaacagctggaggccgaagg
cagcgtggacgtgctggccaccgtctgtgccctgcgtggggacaggggcggcatggtcca
aaccgccgagcagtacgagtttgtgcaccggaccctctgcctctttgagcagcagctgcc
gtga

DBGET integrated database retrieval system