KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW017853Help
Entry
IscW_ISCW017853   CDS       T01131                                 

Definition
mRNA export protein, putative (EC:2.7.11.7)
Orthology
K14298  
mRNA export factor
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    IscW_ISCW017853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 367 aa AA seqDB search
MFASANNSVNFGGGVGMFSAASATGTHNPMKDFEVVSPPDDSISSLAFSPASLPQNFLIA
GSWDNQIRCWEVQSTGQTIPKAQQTHQGPVLDVAWSDDGTKVFSASCDKTVKMWDLNSNQ
ALPIAQHDAPVKTVHWLKAPNYTCIMTGSWDKTLKFWDTRTPTPMLTITLPERCYCADVV
YPMAVVSTAGRGIIVYQLEGQPQEYKKIESPLKYQHRCVSIFLDKKSQPSGFGLGSVEGR
VAIQYVNPQNPKDNFTFKCHRANGTTNGFQEIFAVNDIAFHPVHGTLATVGSDGKFSFWD
KDARTKLKTSEQMEQPVTRCCFNARGEIFAYSVSYDWSKGHEFYNAQKKNYIFLHSCFEE
LKPRTKK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgtccgctaacaactccgtcaacttcggtggcggcgtgggcatgttttcggca
gcttctgccaccggcacgcataacccgatgaaagacttcgaggtcgtttcgcccccggac
gattccatcagtagcctggcttttagcccggcctcgctcccgcagaacttcttgattgcc
ggcagctgggataaccagataaggtgctgggaggtgcagagcacgggacagaccattccc
aaggcgcagcagactcatcagggacctgtgctcgacgttgcctggagcgacgatggcacc
aaggtcttctcagcgtcctgcgacaagaccgtgaagatgtgggacctgaacagcaaccag
gccctcccgattgctcagcacgacgccccggtaaagaccgtccactggctcaaggccccc
aactacacctgcatcatgacgggcagctgggacaagacactcaagttttgggacacaagg
acgccaacacccatgttgaccatcacccttcctgagcgctgctactgtgcagacgtggtg
tacccgatggccgtggtgagcactgcgggcagaggcatcatcgtctaccagctggagggc
cagccgcaggagtacaagaagattgagtccccgctcaagtaccagcaccgctgtgtctcc
atcttcctggacaagaagtctcagcccagtggctttggcctgggcagcgtggagggccgg
gtggccatccagtacgtgaacccgcagaaccccaaggacaacttcaccttcaagtgccac
cgggccaacggaaccaccaacggcttccaggagatctttgcggtgaacgacatcgccttc
caccccgtgcatggcaccctggccacggtgggctctgacggcaagttcagcttctgggac
aaggatgcccgtaccaagctcaagacctccgagcagatggagcagcccgtgacgcgctgc
tgcttcaacgcccggggcgagatctttgcctactccgtcagctacgactggtccaaggga
cacgagttctacaatgcgcagaagaagaactacatcttcctccactcctgcttcgaggag
ctcaagccacgcacaaagaaataa

DBGET integrated database retrieval system