KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW018301Help
Entry
IscW_ISCW018301   CDS       T01131                                 

Definition
mitogen-activated protein kinase, putative (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     IscW_ISCW018301
Protein kinases [BR:isc01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   IscW_ISCW018301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 304 aa AA seqDB search
HIAYRFEMLKVIGKGSFGQVVKAYDHKQHQHVALKMVRNEKRFHRQAQEEIRILDFLRRQ
DRDNSLNMIHMLEHFSFRNHTCITFELLSINLYELIKKNKFQGFSLQLVRKFAHSLLQCL
DALHRSHIIHCDLKPENVLLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILG
AKYGMPIDMWSLGCILAELLTGYPLLPGEDEADQLACIMELLGAPPQKLLDQAKRAKNFI
SSKGYPRYCTDWSAALKGCDDTLFVDFLKRCLEWDPATRMTPSAALRHAWLRRRLPRTPQ
TTAS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
cacatcgcgtaccgcttcgagatgctcaaggtgatcggcaagggcagcttcggccaggtg
gtcaaggcctacgaccacaagcagcaccagcacgtggcgctgaagatggtccgcaacgag
aagcgcttccaccggcaggcccaggaggagatccgcatcctggactttctccggcgccag
gaccgcgacaactcgctcaacatgatccacatgctggagcacttcagctttcgcaaccac
acgtgcatcaccttcgagctgctctccatcaacctgtacgagctgatcaagaagaacaag
tttcaggggttctccctccaactggtccgtaagttcgcccactccctgctccagtgcctg
gacgcgctgcaccgaagccacatcatccactgcgacctgaagcccgagaacgtgctgctc
aagcagcagggacgctcgggcatcaaggtcatcgacttcggctcgtcctgcttcgagcac
cagcgtgtctacacctacatccagtcgaggttctaccgggcccccgaagttatcctgggc
gccaagtacggcatgcccatcgacatgtggagcctgggctgcatcttggccgagctgctc
acgggctacccgctactgccgggcgaagacgaggccgaccagctcgcctgcatcatggag
ctgctgggcgcgccgccccagaagctcctcgaccaggccaagcgggccaagaacttcatc
agctccaagggatacccccgctactgcaccgactggtcggcggcgctgaagggctgcgac
gacaccctcttcgtggactttctcaagcggtgtctcgagtgggacccggccacgcggatg
acgccctcggcggccctgcggcacgcctggctgcggcgacggctacccaggacgccgcag
acgacggcgtcg

DBGET integrated database retrieval system