KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW018513Help
Entry
IscW_ISCW018513   CDS       T01131                                 

Definition
ubiquitin specific protease, putative (EC:3.1.2.15)
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     IscW_ISCW018513
Peptidases [BR:isc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   IscW_ISCW018513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 844 aa AA seqDB search
MHRILAGIAKSDHPEDVKQNLIEKKLIPAASQPMAPGDCESLLEVSWSLATTGETEFLQN
GGISVFTAFCEHHKSALAQFFTQSHLITALTSPGVIHKDRMLQLLTGVLSQMEQEPVFPK
LCCVVQTRCISLLKETCGSLSVCCSMVVMLERFPQCLPKEEFRGKLCSVLTQCIVASPCP
SQAQDLKPYITDINRVSTFLKLLPSSLVPAATSSLSRSLAGGVDVEPLVLASERLLACLS
WPGTSMVHVWVLAALQGFLSMGRFGAVRDLFESQVKSVFVRVSHPLTRKCAFPVLSFMLL
SYQHSPSLFHKVVPDVPQLMKLLKKEKNDDAALEVASLSQTLMYVHSGFPDLYDPVLDAL
KEFPSPRQEEMQNLLAMYRMDVPQKYVGGIVGDISTVSRREDELVGLVNLGNTCYANSVL
QALYMTSRLRNELLQTNSIPAGTNLKRLQELFAFLMLSQRPAVSPESFLSKSRPSWFEWG
EQQDCSEFLRFLVDSLHEEHRAHRLWRPAADPKGGGASAAASRTLVEEVFGGSVKTTYHC
LTCGRDSVNEEAIMDLHLAFPEGSVTKDGGGADAKSGQRRLASKEGGGEEAAAPPRPLSV
EDLLESYFEPESMEGDNKYHCNACGALRDARRTVALAEPPRHLILTLMRFSYDNATRTRS
KILHNVAYPKLLVLPENCGLAERAAYALYAVVVHSGTSADRGHYYTARHATGAWCPAVGD
QSNAVLHRDGRLFPPQESLSPRKSAYRASTSDLDPLSKKWYLFNDSRVSNASYATFETLT
RRFPKDTAYVLFYKHVNSSLAYQEAAPTSDDVHASLRSLVELDNTKYLELTAYFFNASHS
LDLC
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgcatcggatccttgcaggaatcgcgaagtccgatcaccccgaagacgtgaagcagaat
ctaatcgaaaagaagctgataccggcagcgtctcagccaatggctcccggcgactgcgag
tcactgctggaggtttcgtggagccttgccactactggagagacagaattccttcagaat
gggggcatttcggttttcacagcattctgtgaacatcacaagagtgcactggcgcagttc
ttcacccagtctcacctcatcacggcccttacttcaccaggagtcattcacaaagacagg
atgctccagctgctcacgggagtgctgtcccagatggagcaggagcccgtctttcccaag
ctgtgctgcgtcgtgcagacgcgctgcatcagcctgctcaaggagacgtgcggctcgctc
tccgtctgctgctccatggtcgtcatgctggaacgcttcccccagtgcctcccaaaggag
gaattccggggcaaactgtgttcagtgctgacccagtgcattgtggcttcaccgtgtcct
tcgcaagcgcaagacctcaagccttacataacggacatcaaccgcgtgtccacgttcctc
aagctgctcccgtccagcctggtccccgccgccacgagttcgctgagcaggagcctggcg
ggcggcgtcgacgtggagcccctggtgctggcgtccgaacggctgctggcctgcctcagc
tggcccggcacctcgatggtccacgtctgggtcctggccgcccttcaggggttcctctcc
atggggcgcttcggcgccgtccgagacctcttcgaatcccaagtcaagtcggtgttcgtc
agagtgagtcacccgctgacgcgcaagtgtgcgtttccggtcctttccttcatgctgctc
tcctatcagcactcgccctccctctttcacaaggttgtgcccgacgtgccccagctgatg
aagttactgaagaaggagaaaaacgacgacgccgccctggaggtcgccagtttgtcccag
accctgatgtacgtccactctggcttcccggatctgtacgatcccgtcttggacgcactc
aaggagtttccgtcgcctcgccaagaagagatgcagaaccttctggcgatgtaccgcatg
gacgtgccgcagaagtacgtggggggcattgtcggggacatctcgacagtgtctcggcgg
gaggacgagctcgtgggactcgtaaatctgggcaacacgtgctacgccaacagcgtgctc
caggcgctgtacatgacctcgcggttacgaaacgagcttctccaaaccaacagcattcca
gcgggaacaaacttgaagaggctacaggaacttttcgctttcctgatgttgtcgcagcgc
cccgccgtgtctcccgagagcttcctgagcaagtcgaggccgtcgtggttcgagtggggc
gagcaacaggactgctcggagttcctgaggttcctcgtcgactctctgcacgaagagcac
agggctcaccgtttgtggcggcccgccgctgaccccaaaggtggcggcgcctccgccgcc
gccagtcggactctcgttgaggaggtgttcgggggttcggtgaagacgacgtaccactgc
ctgacgtgcggtcgcgacagcgtcaacgaggaagccatcatggacctccacctggcgttt
ccggagggatcggtgaccaaggacggcggtggcgcggacgccaagtcgggtcagaggagg
ctggcgagcaaggagggcggcggcgaggaggcggcggcgccaccgaggccgctctcggtg
gaggacctgctggagagctactttgagccggagagcatggagggagacaacaagtaccac
tgcaatgcctgcggcgcactgagggacgcccggcgaacggtggcgctcgccgaacctcca
agacacctcatcctgaccctgatgcgtttctcgtacgacaacgccacgcggacgcgctcc
aagattctgcacaacgtggcctaccccaaactcctggtgctacccgaaaactgcggcctg
gcagaaagggcggcctacgccctctacgccgtggtggtccactcggggacctcggcggac
cggggccactactacacggcacgtcatgcaactggcgcttggtgtcccgccgtcggagac
cagagcaacgccgtccttcatcgagacggacgtctctttccgcctcaggagtcgctgtcc
ccgcggaagtccgcctaccgggcgagcaccagcgacctcgaccccctgtcgaagaagtgg
tacctgttcaacgacagccgggtctccaacgcctcctacgccaccttcgagacgctgacc
cgccgttttcccaaggacaccgcctacgtgctcttctacaagcacgtcaactcgtccctg
gcctatcaggaggcggccccgacgtcagacgacgtccacgcctccctcaggagcctcgtc
gagctcgacaacaccaagtacttggagctgaccgcttactttttcaacgcaagtcacagc
ctggacctttgctga

DBGET integrated database retrieval system