KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW018753Help
Entry
IscW_ISCW018753   CDS       T01131                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:isc00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    IscW_ISCW018753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 995 aa AA seqDB search
MRARGGAEIILTLRPLWSRGDECSHVTGRRARCRDVRARNELPRGFPASFLAPGEWKLLP
RMRRMTRGNVTMCGRVAASLDPGGTRLLAISMKTVSVALVMCLNIGVDPPDVVKTQPCAR
LQCWLGEDAGIRRSPPQKALEAIGAALQKQYERWQSRARYKLSLDPTVEEVKKLCSSLRR
NSKEDRVLFHYNGHGVPKPTVNGEIWVFNRSYTQYIPLSMYDLQQWMGAPSIYVYDCSSA
GLILDSFNKFAVQHEREFEISLGVKGQAPPSYRGCIQLAACRPHQVLPMSPELPADLFTS
CLTTPVQMALRWFVLQGGSRLVPNVTLELLERVPGQLHDRRTMLGELNWIFTAITDTIAW
NVLPKALFQKLFRQDLLVASLFRNFLLAERIMRAYNCQPMSQPALPATFQHPMWQAWDLA
LDLCLAQLHRVQAGQPFQHSLFFAQQLTAFQDLLVASLFRNFLLAERIMRAYNCQPMSQP
ALPATFQHPMWQAWDLALDLCLAQLHRVQAGQPFQHSPFFAQQLTAFQVWLTFGCERCSP
PEQLPIVLQVLLSQIHRLRALDLLGRFLDLGPWAVNLALSVGIFPYILKLLQSSARELRP
LLVFIWAKILAVDQSCQVDLVRDNGHRYFLSVLSDTLYMPAEHRTMAVFVLSCIVCNYPS
GQEAALKGNVIALCTEQLTDPNGHLRQWLALCLGRTWNGYTAARWCGIRDSAHDKLATLL
SDPVPEVRAAAVYALGTILNCPAKRTDHADTVDQGIGMSLISSVAHDASPLVRKELVVAL
QWLLAVFETQFVAVAFQFLEEETKEQSTFLSPASSFESTEPPGKLSWLRWHLERGGLFVA
DCTPAAMKKVASRDRIKLLPIPSNILSAAVVDGLPEAALAAPAQPPRRTGCGGSRRARPS
LAWDRRGPGGRRGARPGAGMVLDWDQQTTTLIASGDVRVIRVWDTGQEKKILDMPTGADY
PITSLSTDHQGSLLVAGCGDGTIRVYDRRLPPADW
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgaggggcggtgcagagatcatcctgaccttgagaccgctctggtcacgaggt
gacgagtgcagtcacgtgacaggtcgccgtgcccgctgccgcgacgtgcgtgcacgcaac
gagcttccacgaggattccccgcgtcattcttggcgccgggcgagtggaagctccttccg
cgcatgcgccgaatgacaaggggcaacgttacgatgtgtggtcgtgtggccgcttctcta
gaccctggagggactcgattgcttgccatctcgatgaagactgtgagcgtagccctggtg
atgtgcctcaacataggagtggatccacccgacgtggtcaagacgcagccgtgcgccagg
ctccagtgctggctcggtgaggatgccggcatccgcagatcgccgccgcagaaggccctg
gaggcgattggggcggccctgcagaagcagtacgagcggtggcagtcccgggcacgctac
aagctcagcctggaccccaccgtggaggaggtgaagaagctctgctcctccctccggaga
aactccaaggaagacagagtgctgtttcactacaacgggcacggggtgcccaagcctacg
gtcaacggcgagatctgggtgtttaatcggagctacacccagtacatcccgctgtccatg
tacgacctgcagcagtggatgggggcaccttccatctatgtgtacgactgctcctcggcg
ggactcatcctcgattccttcaacaagtttgccgtccagcacgagcgggagttcgagatc
tccctcggggtcaagggacaggccccgccttcctacaggggctgcatacagctggccgcc
tgcaggccacaccaggtgctgcccatgagccccgagctacccgcagacctgttcacgtcg
tgcctgaccacgccagtccagatggccctgcgctggttcgtgctgcaggggggctctcgc
ctggtgcccaacgtcaccctggagctgcttgagcgggtgcccggccagctccacgaccgg
cgcaccatgctcggggagctcaactggatcttcaccgccatcacggacaccatcgcctgg
aatgtgctgcccaaggccctcttccagaagctctttcgacaggacctgttggtggccagc
ctgttccgcaacttcctgctggcggagcgcatcatgcgcgcctacaactgccagcccatg
tcccagcccgccctgccggccaccttccagcaccccatgtggcaggcctgggaccttgcg
ctggacctctgcctggcacagctccaccgggtccaggcgggacagcccttccagcactcg
ctcttctttgcccagcagctcactgccttccaggacctgctggtggccagcctgtttcgc
aacttcctgctggcggagcgcatcatgcgcgcctacaactgccagcccatgtcccagccc
gccctaccggccaccttccagcaccccatgtggcaggcctgggaccttgcgctggacctc
tgcctggcacagctccaccgggtccaggcgggacagcccttccagcactcgcccttcttc
gcccagcagctcactgccttccaggtttggctgactttcggctgcgagcggtgctcccct
ccggagcagctgcccattgtgctccaggtgctcctgagccagatccacaggctcagggcc
ttggacttgctcgggaggttcctggacctgggaccttgggccgtcaacttggctctgtcg
gtgggcatcttcccgtacatcctgaagctgctacagagctccgcccgggaactgcggccc
ctcctcgtcttcatctgggccaagatcttggccgtggaccagtcctgccaggtggacctg
gtgagggacaacgggcaccgctacttcctgagcgtcctctcggacaccctgtacatgccc
gcggagcaccgcaccatggccgtcttcgtcctgtcctgcatcgtctgcaactaccccagc
ggacaggaagccgcactcaagggcaacgtgatagcgctgtgcacggagcagctgacggac
ccgaacgggcacctgcgccagtggctggccctgtgcctgggacgcacctggaacggatac
acggccgcccgctggtgcggcatacgggacagcgcccacgacaagctggccaccctgctc
agcgaccccgtgcccgaggtgcgagcggcggcggtgtacgccctgggcacgatcctgaac
tgcccggccaagcggactgaccacgcggacacggtggaccagggcattggcatgagcctc
atctcatcggtggcccacgacgccagcccgctggtgcgcaaggagctggtggtggccctg
cagtggctgctggcagtcttcgagacgcagttcgtggccgtggccttccagttcctcgag
gaggagaccaaggagcagtcgaccttcctcagcccggctagttcctttgagtcgacagaa
ccgcccgggaagctgtcttggctgcgctggcatctggagcggggtgggctctttgttgca
gactgcacgccggcggcgatgaagaaggtggcctcaagggaccgcatcaaacttctgccc
atccccagcaacatcctgtctgcggcggtggtggacggcctcccagaggcggccctggcg
gcgcccgcgcagcctccgcggcggaccggatgcggcgggtctcgtcgagcacgtccatct
ctagcctgggaccgtcgggggcctggggggcggcggggtgcacggccaggtgctgggatg
gtgctggactgggaccagcagacgaccaccctgattgcgtccggagacgtcagggtcatc
cgcgtctgggacactggtcaggagaagaaaatcctggacatgccgacgggggcggactac
ccgatcacgagcctctccacggaccaccaggggtcgctgctggtggctggctgcggggac
ggaaccatccgggtctacgatcggagactgccgccggcggactggtga

DBGET integrated database retrieval system