KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW018973Help
Entry
IscW_ISCW018973   CDS       T01131                                 

Definition
hypothetical protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
isc  Ixodes scapularis (black-legged tick)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1161 aa AA seqDB search
MVLSASVVRPSEGGRTQQLTSKIKVFERRLKDLEDEAKSMEVCFDQKVKGIRAAASLFQY
KLNRFQQLAALINRREFQQAVLEAEMENLQGFTSRVPVILQRLRRRRPAPRMAQDSLKMI
SSSVSLGLGRSPLSLNQQVAGGSRSSVLLHHIDFESCDNGGAKHTSEALRAKYAPLSPAP
VHNGTLSKTAATALHKIGGKPAATSNGTVVANGATCNGSSSSDEGIPEPRVRLHSPEAVW
LDWREVRKIGAGLVNLGNTCFMNTVIQCLTYCPPLANYLLHQDNHCAKCKTINFCMMCEL
QKHMRRALDKPGDAIKPIYIYQRLKGGPLLFPQPMSNASSLEKALEKFVEPELLQNDNAY
KCPRCNVKVEAQKRFTVHRPPNVATFQFKRFDSNRMFGGKITKHVSYPERLEMRPFMSDK
QEDAHEFLRYVVDNLWKAALANHDGGPKLDPASKETTVVNEIFGGYHRSQVICMRCKKTS
NTYDHFMDLILDIKNASSLEKALEKFVEPELLQNDNAYKCPRCNVKVEAQKRFTVHRPPN
VATFQFKRFDSNRMFGGKITKHVSYPERLEMRPFMSDKQVHQVSLGQVLNQQAYVLFYVR
TSPPKGSPSVKKSSSAAAIAVRNVPEPVRNGHVSAAAVATVAEMGETTAQRLRQPPPKSP
SSPAAMTAAGTPSVNGHPPSSPATPLPLNRAKVAFGISRPAALTSATRTESSASPAPSPS
VSKAVTPRPTPIPSTPSGSTTTTEASLVPYAGDSSDSDSDERVPPSSAEKSRVGGKGSAL
STSSRGIAKGASSSSLHVSGMMSPSLASESSTTSVNSTTDWNVTDREDVQADATSTVPQA
RKPVPEAFPGWTVKPDASSSAVVDVVVVHTEEGEAAQETEETRLQPFRGEAGVIGAARAG
GSGDARRDAGAVRGAVGSGAGVAPQPVPVAGAAVQAVPLAPGRESGGRVSAADTDDSSDS
HEWVERTKETLAAERAGRLSAPAALGGSVPVHRWDDRLDRNGVASSPQRPPWNGNNKRPD
VVSYLQDAGSRQYGFAANGWSNRSNPGYNGYGGYNGERGAGDYARDKRKYYDDYDSYDDE
YDKGKKRKNGGFGPPPFQRQYRGNPFQDAQNFRNQQGRFQQQFDRFQKTGGPPFYQRHHE
RRHTDYGRGPRRKHHFYGRTR
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atggtcttgagcgctagcgttgtgaggccgtccgaaggcgggagaacccagcaactgacg
tcgaagatcaaggtcttcgaaaggcgtctcaaagatctcgaagacgaagcgaagtcgatg
gaggtttgtttcgaccagaaggtgaagggcatcagggcagcggcgagcctttttcagtac
aaactgaacaggtttcagcaactggcggctctgatcaatcgacgagagtttcagcaagcc
gtacttgaagctgaaatggagaacctgcaaggtttcacgagccgggttcccgtgattctt
cagcggctccgtaggagaaggccggcccccaggatggcgcaggacagcctgaagatgatc
agcagctcggtcagcctcgggctcggccggagtccgctgtctctgaaccagcaggtcgca
ggtggctcaaggtcgtctgttcttcttcatcacatcgactttgagtcatgcgacaacgga
ggtgccaagcacacgtcggaggcgctgcgcgccaagtatgcgccactttcgccggcgccc
gtccacaacggcaccctctccaagacggctgcgacggcgcttcataagattggtggcaag
ccagccgcaacttcaaacggcacggtggtagccaacggcgccacgtgcaacggctcttcg
tcttcggacgaaggcatccctgagccacgagtgcgactccactcgccggaggcagtgtgg
ctggactggcgggaagtgcgcaagatcggcgcaggcctggtgaacctgggcaacacgtgc
ttcatgaacactgtgatccagtgcctgacgtattgcccgcccctggccaactacttgctt
caccaggacaaccactgtgccaagtgtaaaacaatcaacttctgcatgatgtgcgagctg
cagaagcacatgcggagagccctggacaagcccggggatgccataaagcccatctatatt
taccagaggctcaaaggtgggccccttctttttcctcaaccaatgtcgaacgcctccagc
ctggagaaggccctggagaagtttgtggagcccgagctgctccagaacgacaacgcctac
aagtgcccccggtgcaacgtgaaggtggaagcccagaagcgcttcacggtgcacaggccg
cccaacgtggccaccttccagttcaagcggttcgattcgaaccggatgtttgggggcaag
ataacgaagcacgtgagctacccggagcgcctggagatgcggcccttcatgtcggacaag
caggaggacgcccacgagttcctacgctacgtcgtggataacctgtggaaggccgccctc
gcgaaccacgacgggggacccaaattggatcccgccagcaaggagacgacggtcgtcaac
gagatttttggcggctaccaccgcagtcaagtcatctgcatgaggtgcaagaagactagc
aacacgtacgaccacttcatggatctaatcctcgacattaagaacgcctccagcctggag
aaggccctggagaagtttgtggagcccgagctgctccagaacgacaacgcctacaagtgc
ccccggtgcaacgtgaaggtggaagcccagaagcgcttcacggtgcacaggccgcccaac
gtggccaccttccagttcaagcggttcgattcgaaccggatgtttgggggcaagataacg
aagcacgtgagctacccggagcgcctggagatgcggcccttcatgtcggacaagcaggtt
caccaggtgagcctaggtcaggtgttgaaccagcaagcctacgtgttgttctatgtgcgg
acgtcgccacccaagggctcgccatctgtcaagaaatcgagctcggcggccgccatcgcg
gttcggaacgtcccggagcccgttcggaacggacatgtctcggcggcggcagtggccacg
gtggcagagatgggggagaccaccgcccagcggctccggcagcctccgcccaagtctcca
tcctccccggcggccatgacggctgccggcaccccctccgtcaacggccacccgccctcc
tctcccgccacccccctccctttgaaccgcgccaaggtggccttcggaatctcgcgcccg
gcggcgctgacgtctgctacgaggactgagagttcggcgtctcccgccccttccccttcc
gtctcgaaggcagttacccctaggcctacccccattccgtcgaccccgtccggcagcaca
accacgacggaagcaagtctagtcccttacgcgggcgactcttcggactccgattcagat
gagagggtacctccgtcgtctgcagagaaaagccgcgtcggcggaaaggggtcggcactg
tctacgtcgtcgcggggaattgcaaagggagcatcgtcgtcgtcgttgcacgtgtctgga
atgatgtcgccctcgctcgcctcggagtcgagcacgacgagcgtcaactcgacgacagac
tggaacgtgactgatcgagaagacgtgcaagcggacgcgacctccacggtgccacaggcg
cgcaagcccgtgcccgaggcatttccgggctggacggttaagcccgacgcaagttcgtcc
gccgtcgtcgacgtcgtcgtcgtccatacggaggaaggagaggccgcccaggagacggaa
gagacccggctgcagccctttcggggggaggcgggcgtcatcggtgcggcgcgggctggg
ggctctggtgacgctcggagagacgctggtgcggtgcgcggggcggttggcagcggcgcc
ggcgtggcgccgcagcctgtgcccgtcgctggggcggcggtccaggcggtgccgctggcg
ccgggacgggagtccggcgggcgtgtgagtgcggcggacacggacgacagcagcgactcg
cacgagtgggtcgagcggaccaaggagacgttggctgccgagagagcgggacggctctcg
gcccctgcggcgttgggcggctcagtgcccgttcaccgctgggacgaccggctcgaccgg
aacggcgttgcctcctcgccgcagcggcccccttggaacgggaacaacaagaggcccgac
gtcgtgagctacctccaggacgccggttccaggcagtacggctttgccgcgaatggctgg
agcaaccgaagcaatcctggctacaacggatacggcggatacaatggcgagcgaggggcc
ggcgactatgcgagggacaagcggaagtattatgacgactacgacagctacgacgacgaa
tatgacaagggcaagaagcggaagaacggcggctttgggccacctccgttccagcggcag
tacaggggcaacccctttcaggacgcgcagaacttcagaaaccagcaaggtcgctttcag
cagcagtttgacaggtttcagaagaccggtggcccgccgttttaccagcgccatcatgaa
cgccgtcacacggactacggcagaggaccgcgtcgcaagcaccacttctacgggcggacc
aggtag

DBGET integrated database retrieval system