KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW019420Help
Entry
IscW_ISCW019420   CDS       T01131                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase, putative (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     IscW_ISCW019420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 277 aa AA seqDB search
MHPGRAFFALGTFLAATFWTMAWRSHGKTNLELVRNLKHNGIIRSAKVEQVMSQVDRGHY
VKHNPYMDSPQGIGYAVTISAPHMHAQALESLKDHLYEGAKALDVGSGSGYLTVCMALMV
GETGRTIGIDHIPELVDQSIANIHKGHPALLDSKRLRMIVGDGRVGYPEEAPYDAIHVGA
AAPELPKQLIEQLKPGGRLICPVGPAGQSQTLEQVDKLQDGTVKRTSLMGVVYVPLTDKE
AQWPGRWLTEVANYRKRLGTKEGTLSSAAGRSPPPTE
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcaccccggcagagcattcttcgccctgggaacgtttctggccgccactttttggacc
atggcttggaggtcgcacggcaagaccaacctcgagctggtgcggaatctcaaacacaac
ggcatcataaggtcggctaaagtggagcaggtgatgagccaggtggacaggggtcactac
gtcaagcacaacccgtacatggactccccgcagggcatcggctatgcagtcaccatcagt
gcacctcatatgcatgctcaggccttggagagcctcaaggaccacctgtacgaaggggcg
aaagctctagacgtcgggtcaggcagcggctacctgacggtctgcatggcactcatggtg
ggcgaaacggggcggacgataggcatcgaccacatccccgagctggtcgaccagtctatc
gccaacatccacaagggccatcctgcgctcctagactccaagaggcttcgcatgatcgtt
ggggacggccgggttggctacccggaagaggccccgtacgacgccatccacgtgggagct
gccgcccccgagctgcccaagcagctgatagagcagctgaagcccggcggccggttgatc
tgtcccgtggggccggcgggccagagccagaccctggagcaggtggacaagctgcaggac
gggacggtcaagcgcacctccctcatgggcgtggtctacgtcccgctcaccgacaaggag
gcccagtggcccggcaggtggctcaccgaagtggcgaactataggaagaggctcggcacc
aaagagggaactctgtcgtctgctgccggccgatcaccgccacccaccgaatga

DBGET integrated database retrieval system