KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW019441Help
Entry
IscW_ISCW019441   CDS       T01131                                 

Definition
clathrin heavy chain, putative
Orthology
K04646  
clathrin heavy chain
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:isc00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    IscW_ISCW019441
   04142 Lysosome
    IscW_ISCW019441
Exosome [BR:isc04147]
 Exosomal proteins
  Proteins found in most exosomes
   IscW_ISCW019441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1616 aa AA seqDB search
MTQMLPIRFQEHLQLTNIGINAANVGFNTLTMESDKFICVREKVGDAAQVVIVDMANPTS
PIRRPISADSAIMNPASRVIALKASRTLQIFNIEMKSKVKAHTMTEDVVFWKWINVNTIA
LVTEGAVYHWSMEGDSQPQKMFDRHSSLSGCQIINYRTDAKIQWLLLIGISAQQNRVVGA
MQLYSMERKVSQPIEGHAAAFAQFKQEGNTEASTLFCFAVRTPHGGKLHIIEVGQPAAGN
QAYPKKAVDVFFPPEAQNDFPVAMQMSPRHDVVYLITKYGYVHLYDLESGTCIYMNRISA
DTIFVTAPHEASSGIIGVNRKGQVLSVSVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EDLFVVKFNTLFGGGQYSEAAKVAANAPKGILRTPQTIQRFQQVPNQPGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKDDKLECSEELGDLVKQVDPTLALSVYL
RANVPNKVIQCFAETGQFQKIVLYAKKVGYVPDYVLLLRQVMRVNPDQGASFAQMLVQDE
EPLADINQIVDVFMESNLVQQCTAFLLDALKNNRPSESNLQTRLLEMNLMTAPQVADAIL
GNQMFTHYDRAHVAQLCEKAGLLQRALEHYTDLYDIKRAIVHTHLLNAEWLVNYFGSLSV
EDSLECLRAMLTHNLRQNLQISVQVATKYHEQLTTASLIDLFESFKSYEGLFYFLGSIVN
FSQDPEVHFKYIQAACKTGQIKEVERICRESNCYNAERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNSLQKYIEIYVQKVNPSRLPVVVGGLLDVDCAEEVIKGLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEGRLHEGCQEPATHNALAKIYIDSNNNPERFLRENQFY
ESRVVGRYCEKRDPHLACLAYERGQCDRELVQVCNDNSLFKSEARYLVRRRDPDLWAEVL
AESNPFRRPLIDQVVQTALSETQDPEDISVTVKAFMTADLPNELIELLEKIVLENSVFSD
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAIGSELYEEAFAIFRKFDVNTS
AIQVLIEHIQNLDRAYEFAERCNEPGVWSQLARAQLGQGLVKEAIDSFIKAGDHTAYLDV
VQTAHKTGSWEDLVRYLQMARKKGRESYVESELIYAYAKTNRLADLEEFVSGPNHADVQR
IGDRCFEDGLYEPAKLLYNNVSNFARLAITLVHLKEFQGAVDSARKANSTRTWKEVCFAC
VDNEEFRLAQMCGLHIVVHADELEDLIHYYQDRGFFEELIALLEAALGLERAHMGMFTEL
AILYSKYKPAKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEFDNAVVTMMQ
HPTEAWREAHFKEIITKSKQAETAEELLSWFLDDKNYACFGACLFQCYDLLHPDVILELA
WRHGIMDFAMPYFVQVMREYVSKAINEALNGLLIDEEDFQGLRTSIDAFDNFDNIALAQR
LEKHDLVEFRRLAAYLYKGNNRWKQSVELCKKDRLFKSKQAETAEELLSWFLDDKNYACF
GACLFQCYDLLHPDVILELAWRHGIMDFAMPYFVQVMREYVSKVGAVALAALPRIR
NT seq 4848 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaatgttaccgatacggttccaagagcatttacagctcaccaacataggcatc
aatgcggccaacgtgggcttcaacacgctcacgatggagtccgacaagttcatctgcgtg
cgcgagaaggtgggggatgcggcgcaggtggtcattgtggacatggctaaccccaccagc
cccatccgaaggcccatttctgccgactctgccatcatgaacccggcctcgagggtcatc
gccctcaaggcctcaaggacgctgcagatcttcaacattgagatgaagagcaaggtgaag
gctcacacgatgaccgaggacgtagtgttctggaagtggatcaacgtgaacacaattgcc
ttggtcacggagggagcagtctaccactggagcatggaaggggattctcagcctcagaag
atgttcgaccgccactccagtctgagtggttgccagatcatcaactataggacggacgcc
aagatccaatggctcctgcttatagggatttctgcccagcaaaaccgagtggttggagcg
atgcagctgtattcgatggagcgcaaagtgagccagcccattgagggccatgcagcggcc
tttgcgcagttcaagcaggagggcaacacggaggcctcgacgcttttctgctttgcagtc
cggacccctcatgggggaaagctgcacatcattgaggttggccagccagcggcgggcaac
caggcctacccgaagaaggctgtggacgtgttcttcccccccgaagcccagaacgacttc
cccgtggccatgcagatgagcccgaggcacgatgtggtctacctgatcaccaagtatggc
tacgtacacctgtacgacctggagagcggcacctgcatctacatgaaccgcatctcggcc
gacaccatcttcgtcacagcaccccacgaggcctcctcgggcatcatcggggtgaatcgc
aagggacaggtgctctcggtgagcgtggaggaggagaacatcatcccgtacatcacaaac
gtgctgcagaacccggacctggcgctgcgcatggcggtgcgcaacaacctggccggggcc
gaagacctgttcgtagtcaagttcaacaccctgtttgggggcggccagtactcggaggca
gccaaggtggcggccaacgcgcccaagggcatcctgcgcaccccgcagacgatccagcgc
tttcagcaggtgcccaaccagcccgggcagacctccccactgctgcagtacttcggcatc
ctgctggaccaggggcagctgaacaagtatgagagcctggagctgtgccgccccgtgctg
cagcaggggcgcaagcagctcctcgagaagtggctcaaggacgacaagttggaatgcagt
gaggaactgggggacctggttaagcaagtggacccaaccctggccctctcagtttacctc
cgtgcaaatgttcccaacaaggtgatccagtgctttgcggagaccgggcagttccagaag
atcgtgctgtatgctaagaaggtgggctatgtgccggactacgtgctgctgctgcgccag
gtgatgcgggtgaacccggaccagggagcctccttcgcccagatgctggtgcaggacgag
gagcccctcgccgacatcaaccagattgtggacgtgttcatggagtccaacctggtccag
cagtgtacggccttccttctggatgccctgaaaaacaaccgtccctccgagagcaacctc
cagaccaggctgctggagatgaacctcatgactgcaccacaggttgcagacgccatcctg
gggaaccagatgttcacccactacgaccgcgcccacgtggcccagctgtgcgagaaggct
ggactcttgcagagggccctggagcactacactgacttgtacgacatcaagagagccatc
gtgcacacccacctgctgaatgccgagtggctggtgaactactttggctccttgtcagtg
gaggactctctggagtgcctgcgggccatgctgacacacaacctgcgccagaacttgcag
attagcgtacaggtggccaccaagtaccacgagcagctgacgacggcctctctcatcgac
ctgtttgagtcgttcaagagctacgagggcctcttctacttcctgggctccatcgtgaac
ttcagccaggacccagaggtgcacttcaagtacatccaggcagcctgcaagacgggccag
atcaaggaggtggagcgcatctgccgggagagcaactgctacaacgccgagcgggttaag
aacttcctcaaggaggccaagctgacggaccagctgcccctgatcattgtctgcgatcgc
ttcgactttgtccacgacctggtgctttacctgtaccgcaatagcctgcagaagtacatt
gagatctacgttcaaaaggtgaacccgtcccgtctgcccgtggtggtagggggcctgctg
gatgtggactgtgctgaggaggtgatcaagggcctgatcctggtggtccggggccagttc
tccaccgacgagctggtggccgaggtggagaagcgaaaccgcctcaagctgctcctgccc
tggctggagggcaggctgcacgagggctgccaggagcccgccacccacaacgccctggcc
aagatctacattgactcgaacaacaaccctgaacgcttcctgcgagagaaccagttctat
gagagccgggtggtgggccgctactgcgagaagcgggacccccacctggcctgcctggcc
tacgagcggggccagtgcgaccgagagctggtccaggtgtgcaatgacaactcgctgttc
aagagcgaggcgcgctacctggtgcgccggcgcgacccagacctgtgggcggaggtgctg
gcggagagcaaccctttccggcggccgctcattgaccaggtggtgcagacggccctctcg
gagacccaggaccccgaagacatctcggtgacggtcaaggccttcatgactgccgacctg
cccaacgagctcatcgagctgctcgagaagatcgtgctcgagaactcggtcttcagcgac
cacaggaacctgcagaaccttctgatcctgacggccatcaaggcggaccgcacccgtgtg
atggagtacatcaaccggctggacaactacgacgccccggacattgccaacatcgccatt
ggcagcgagctatacgaggaggccttcgccatcttccgcaagttcgacgtgaacacctcg
gccatccaggttctgatcgagcacatccagaacctggaccgggcctacgagtttgccgag
cgctgcaacgagccaggggtctggagccagctggctagggcccagctgggccagggcctg
gtcaaggaggccatcgactccttcatcaaggcgggagaccacaccgcctacctggacgtc
gtgcagaccgcacacaagaccggctcctgggaggacctcgtgcgctacctgcagatggcc
cgcaagaaggggcgggagtcgtacgtggagtctgagctgatctacgcgtacgccaagacg
aaccggctggccgacctggaggagtttgtgtcgggccccaaccatgcggacgtgcagcgc
atcggggaccgctgcttcgaggacggcctatacgagccggccaagctgctctacaacaat
gtgtctaactttgcacgcctggccatcaccctggtccacctcaaggagttccagggtgca
gtggactcggcgcgcaaggccaactctacgcgtacctggaaggaggtgtgctttgcgtgc
gtggacaacgaggagttccggctggctcagatgtgcggcctgcacatcgtggtgcacgcg
gacgagctggaggacctgatccactactaccaggaccggggcttcttcgaggagcttata
gcgctgctggaggcggccctaggcctggaacgggcccacatgggcatgttcacggagttg
gccatcctctactccaagtacaagccagccaagatgcgagagcacctggagctcttctgg
tctcgggtgaacatccccaaggtgctgcgggccgccgagcaggcacacctctgggccgag
ctagtcttcctctatgacaagtacgaggagtttgacaacgccgtggtcaccatgatgcag
caccccactgaggcctggagggaggctcacttcaaggagatcatcaccaagtccaagcag
gcggagacggcggaggaactgctctcgtggttcctggacgacaagaactatgcctgcttc
ggggcctgcctgttccagtgctacgacctgctgcacccagatgtcatcttggagctggcc
tggcgccacggcatcatggactttgccatgccctactttgtgcaggtcatgagggagtat
gtctccaaggccatcaacgaagccctgaacggcctgctgatagacgaggaggacttccag
gggctgcgcacgtccatcgacgccttcgacaacttcgacaacattgccctggcccagcgg
ctggagaagcacgacctggtggagttcaggcgcctggccgcctacctctacaagggcaac
aaccgctggaagcagtccgtagagctctgcaagaaggaccgtctcttcaagtccaagcag
gcggagacggcggaggagctgctctcgtggttcctggacgacaagaactatgcctgcttc
ggggcctgcctgttccagtgctacgacctgctgcacccagacgtcatcctggagctggcc
tggcgccacggcatcatggacttcgccatgccctactttgtgcaggtcatgagggagtat
gtctccaaggtgggtgccgttgctctcgcagccctcccccgcatcaga

DBGET integrated database retrieval system