KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW019496Help
Entry
IscW_ISCW019496   CDS       T01131                                 

Definition
histone H2B, putative
Orthology
K11252  
histone H2B
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Exosome [BR:isc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   IscW_ISCW019496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 124 aa AA seqDB search
MPPQPSGKAIKKAGKAQKAVRTSDKKKKKRRRKESFSIYIYKVLKQVHPDTGVSSKAMSI
MNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgccaccccagccgagcggaaaagccatcaagaaggccggcaaggcccaaaaagccgtc
cgcacgtccgacaagaagaagaaaaagcgcaggaggaaggaaagcttcagtatttacatc
tataaggtcctgaagcaagtgcatccggacaccggcgtctccagcaaagccatgtccatc
atgaacagctttgtcaacgacatcttcgagaggatcgcagccgaggcgtcgcgtctggcg
cactacaacaagcgttccaccatcaccagccgggaggtccagaccgccgttcgtctgctg
ctgccaggtgaacttgccaagcacgcagtctccgaggggaccaaggcggtcacgaagtac
acctcttcaaagtga

DBGET integrated database retrieval system