KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW019573Help
Entry
IscW_ISCW019573   CDS       T01131                                 

Definition
DNA repair and recombination protein RAD54B, putative (EC:2.7.11.1)
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    IscW_ISCW019573
Enzymes [BR:isc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     IscW_ISCW019573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 680 aa AA seqDB search
RPKDVVKPIPAFRNPHVGGEASGASRKSFHRPTTPLITPNSLVMPRPSHTHQWAHNKKQL
PVVDVVVDASLARCLRPHQQQGLVFLYECIMEMRPFDGGGAILADEMGLGKTLQCITLVW
TLLRQGPYGGYPVLRRIIIITPSSLVKNWVKEFKKWLPNSNLRIYYVGQKNKVEGFLRQP
SLYPVLILSYEMYLRVSDSLANINFDLLICDEAHRLKNANIKIAGSLQNLGITRKILVTG
TPVQNDLQEFFTLIDFCNPGILGKYPYVCQRIGPSSFRRVYEEPILQSRLPQATEEQKEL
GQARANELSRITALFVLRRTQDVVQSYLPGKAECVVFCRPTSLQLTVYRELLASNAVQAC
LSSYLSCDANHHLACILALRKLCNHPSLVTPRHMSLWGCFRSSQDLLPTKSQKQFSLDMS
KLAAESLEASSGKLKVLAAMLASLWDSSPREKIVVVSNFTRMLNVVQELCACKGYTFVRL
DGSTSSTQRLEIVERFNSAHSDCFVFLLSCKAGGVGLNLIGASRIVLYDVDWNPANDLQA
MARVWRDGQGRHVYVYRLVTTGTVEEKIYQRQVMKLDLSRTVLEKKQDGKKAKFSLEDLK
GLFTLEEGTASSTHRLLGCPCDHENNPEMDVSVDPFPSENADTDAAAEAVSAKSQRNCQL
GTPPASSSILGKVGCPRRLE
NT seq 2045 nt NT seq  +upstreamnt  +downstreamnt
acaggcctaaagacgtggtgaaaccaatacccgcattcagaaacccacatgtgggtgggg
aagccagtggtgcaagtcgcaagagttttcacagacctacaacgcctctcataacaccaa
actccctggtgatgcctcgaccaagtcacacccatcagtgggcccacaacaagaagcagc
tgcctgtggtggacgtggtcgtggatgcctctctggccaggtgtctgcgccctcatcagc
agcagggcctggtgttcctctacgagtgcatcatggagatgcggcccttcgatggcggcg
gggccatcctggcagatgaaatgggccttggcaagacgttgcagtgcattacgcttgttt
ggactctgctaaggcaaggaccatacgggggctaccccgttcttcgaaggatcatcatca
ttactccaagcagcctagtcaagaactgggtgaaggagttcaagaagtggctacccaaca
gtaacctcaggatctactacgtcggccagaagaacaaggttgagggtttcctccgtcagc
cgagcttgtaccccgtgctcattttgtcatacgagatgtacctgcgtgtcagtgacagtc
tggccaacataaactttgacctactcatctgtgacgaagctcatcgactaaagaatgcca
acatcaaaatagcggggtccctccagaaccttggaataacacgcaagatcttggtgacgg
gaactcctgtccagaacgacctgcaggagtttttcaccctcatcgacttctgcaatccag
gcattctgggcaagtatccttatgtctgtcagagaatcgggccgtcttctttccggcgag
tgtacgaggaacccatcctgcagtcccgccttccccaggcaaccgaagaacagaaagagc
tgggccaagctcgggccaacgaactctcccggatcactgcattgtttgtgttacgccgta
ctcaggatgtcgttcagagctatctccctggtaaagcggagtgcgtggttttctgccgtc
ccacatcgctgcaactgacggtctaccgggagctgctggcctcgaatgcagtgcaggcct
gcctgagcagctacctttcttgcgatgccaaccatcacctggcttgcattctggcattgc
gcaagctttgcaatcatccttcacttgtcaccccaagacacatgagcttatgggggtgtt
ttcgctcgtcccaggatctattacctaccaagtcccaaaagcagttttctttggacatga
gcaagttggcggcagagagccttgaggcgtcctcggggaagctgaaggtcctggcagcca
tgctggcttcgctctgggactcgtcacctcgggagaagattgttgtcgtctccaacttca
cgaggatgctgaatgttgtgcaggagctttgtgcctgcaagggctacaccttcgtgcggc
tggacgggtcgacatcttccacacaacgcctggaaatcgtggaacgcttcaactctgcac
attcagactgctttgtgttcctgctgagctgcaaggctggaggcgtgggcctgaacctga
ttggggccagtcgcatcgtgctctacgacgtggactggaacccagccaatgacctgcagg
ccatggcacgagtgtggagggacggccaaggacgccatgtctacgtctaccgtctcgtta
ccaccggcaccgtggaagagaagatttaccagcgccaggtgatgaagctggatctgagca
gaacggtcctggagaagaagcaggatggaaaaaaggccaagttttcacttgaagatctca
agggcctgttcacgctcgaagagggcactgcgagttccacccacagacttctgggatgcc
cgtgcgaccatgagaacaacccggagatggacgtctccgtcgacccctttccgtccgaaa
acgcagacacggatgctgccgcagaggccgtgtcggcaaaaagccaacggaactgccagc
ttggaacgccacctgccagcagcagcatactcggaaaggttggttgccctcgacgcttgg
agtaa

DBGET integrated database retrieval system