KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW019794Help
Entry
IscW_ISCW019794   CDS       T01131                                 

Definition
inositol monophosphatase, putative (EC:3.1.3.25)
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    IscW_ISCW019794
  Energy metabolism
   00920 Sulfur metabolism
    IscW_ISCW019794
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    IscW_ISCW019794
Enzymes [BR:isc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     IscW_ISCW019794
    3.1.3.25  inositol-phosphate phosphatase
     IscW_ISCW019794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 331 aa AA seqDB search
MLWHVRSPRAALLLAGCALLALGFFYRSSLSPWDARDASHVSLRRLLLAAVSAAESGGAQ
VRLVRLSNALDQKSKGKTQEGANDPLTAGDLRSHRAIYYGLRRAFPGVAIISEEHDAAGD
PEAPDMVQSASLRGVTLDDVAVPRSRVAVWIDPLDATQEYTENLLDYVTTMVCVAVDGSP
VIGVIHQPFHNRTVWAWVGHGTSPGLVVAPDAHRDPPVVLVSRSHAGEVQDLARNAFGPN
VKLVPAGGAGYKVLEVVSGRADAYLHSSLIKKWDVCAGDALLRALGGRLSALDGSDLQYG
PQDDPKAKGGLLATLHGHAAHLGALRRQRDA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggcacgtccggtccccaagagcggccctcctgctggcgggctgtgccctgctg
gccctggggttcttctaccggagcagcctgtccccgtgggacgcgcgcgacgcgtcgcac
gtgagcctgcggcggctgctcctggctgccgtctcggctgccgagagcggcggcgcccag
gtgcgcctggtgaggctcagcaacgccctcgaccagaagtccaaaggaaagacccaggaa
ggcgccaacgaccccctgaccgccggggacctccgctcccacagggccatctactacggg
ctccggagggccttcccgggagtcgcaatcatctctgaggagcacgatgcggccggggac
ccggaagcccctgacatggtgcagtccgcttccctccgcggggtcacgctggacgacgtg
gccgtgccccgcagcagggtggccgtctggatcgaccctctcgacgcgacgcaggaatac
accgagaacctgctggactatgtgaccaccatggtgtgtgttgcagtcgacggctctccg
gtcattggggtcatccaccagcctttccacaaccgaactgtgtgggcctgggtgggccac
gggacgtccccgggcctggtggtggcccccgacgcgcaccgggacccccctgtggtgttg
gtgtcacgctcgcacgccggagaagtgcaggacctggccaggaacgccttcggccccaac
gtcaagctggtgcctgcaggaggggcaggctacaaggtgctggaggtggtgtccggccgt
gcggacgcgtacctgcacagcagcctcatcaagaagtgggacgtgtgcgcgggggacgcc
ctcctgagggcgttggggggccgcctgagcgccctggatggcagcgacctgcaatacggt
ccccaggacgaccccaaggccaaggggggactgctggccacactgcacgggcacgccgcg
catcttggcgcactgcgtcgccagcgagacgcctag

DBGET integrated database retrieval system