KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW020048Help
Entry
IscW_ISCW020048   CDS       T01131                                 

Definition
mixed-lineage leukemia 5, mll5, putative (EC:2.1.1.43)
Orthology
K09189  
histone-lysine N-methyltransferase MLL5 [EC:2.1.1.43]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    IscW_ISCW020048
Enzymes [BR:isc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     IscW_ISCW020048
Transcription factors [BR:isc03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    IscW_ISCW020048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1231 aa AA seqDB search
MSLALPQSQAQPRLGGPTPNGGAPPHTSCLQPPSSLLPGVDARGPPTPLEVPGVVPQVVV
VPPPPLRPREHKPHTSSLHHHGYANCFGLPYQASGRQHSPDHNYGAPPPPTPPQSPPPAP
QAPVHRVNGAPPPTSLPNGCLEEVKREGASPAEESVTRCICGFNHDDEYMICCDHCSVWQ
HVDCMGLDRSRIPETYLCERCHPRRVDRHRARTLQTRKKQQMSRAPSRVESTSDESGGGA
AGALPGDENRGGDHGGAPHPKGAHPRVRRKRRRSEGKEPAGRQLDPATGDTAATKRLKAK
VKKPKTRFLGLAQVPAKYTPEVQLMAGSLKLNGQHEALTCKVSTAGGDAPWRVEACGGGQ
RRLVATHALGPQQPLLEVRGKFLSASQFRHQNPVFHKRLYPFVLFYQPCAEEETVCVDAR
EYGNEARFVRRSCCPNVQVQHVVHNGLLHLYLVSSRDIAPGQELTIPFDFDYRQCIHSVS
CACGSEDCRVASKGRKAAPPAERKRRGRRVSTSSCGLVEEEPALAKEAARLAPHNDDQPS
LGALAEPQECSPAMASPASDSATGQEGHQGAPEDQESEEQSSAERRRKMTREERKIDAIM
RAFEKMERTEKRRRQALERMAQQHRGGPKHEHPPLPDKLEDERSNDSSLPAAPPEELKPE
PHPEGSTEDRAVSLHRARKGKRRRSTVSRRRSRTVSGGSELLGSPPECEASLEAPPPSAM
HCPLSPPCHREEEPVTAEVPATPPQGAALSPGPSPTGKAFALPKSKRVMEEAPCYVRCTR
DPAPSAVGISAAHLRRNSCSTSAPTSGGSAKKRWLRQAMFESSEEVTEDGGLEGACPGSP
PAAGEDSCQSVSPPPAGGGCCRDVPRWDEPWGPLRGGLDADLVTPLKKRRLVRESRESLD
SMTGGLSPATGEAAATLLSFQAPCLAAPFAAPFHRVEVPPEQSPPGPPPEEEEDPPTPLD
DEESLVDCDESTTEEAAVPEGPRLLPPIPVSLPDPLVMMASHQVPPLDTTAALPPPAATE
VVFSHRIEEVPERPPEAARVATADAPWSGLRTDAVDVSDCSTASSSSSSLCALPPSSPGS
RPLASSGGMLKRKVSLSEYRMRMRETGKAAGVASCKSPLGPPGPPVQDRQGTPLCSPAKG
EEEDDPWGQPRRERLSQRLRREFGLDDDSDSERNPHADGAPTLPPSAAGYQPPLVPHLGT
LQPPGTPRGTPGAAGGTTPPQGRPPQGYFHS
NT seq 3696 nt NT seq  +upstreamnt  +downstreamnt
atgagcctggccctgccccagtctcaggcccagccgcgactggggggccctacccccaat
gggggggcccccccacatacgtcctgcctgcagcctccaagcagcctgctacccggggtt
gatgcccggggtccccccacccccctggaggtgccgggcgtggtgccgcaggtggtggtg
gtgccgccccctcccctccggccgcgggagcacaagccccacacgtcgtcgctgcaccac
catggctacgctaactgcttcggcctgccctaccaggcaagtggtcgacaacattcgccg
gaccacaactacggagcaccccctcccccgacacccccccagagccctcccccggcaccc
caggcccccgtgcacagggtcaacggggcccctcccccgacctccctgcccaacgggtgc
ctggaggaggtcaagcgggagggggcctctcccgcggaggagagcgtcacacgctgcata
tgtggcttcaaccatgatgacgaatacatgatctgctgcgaccactgctcggtgtggcag
cacgtggactgcatgggcctggaccgcagtcgcattcccgagacgtacctgtgcgagcgg
tgccaccctcgcagggtggaccgccaccgggcccgcaccctgcagacgcgcaagaagcag
cagatgagccgggccccgagccgggtggagtcgacttcggacgagagcgggggcggtgcg
gcgggggctctcccgggggacgagaacagagggggggaccacgggggcgccccccacccc
aagggagcccaccccagggtgcggcgcaagcggcgccgctcggagggcaaggagcccgcg
ggcaggcagctggaccccgcgacgggggacacggcggccaccaagaggctcaaggccaag
gtgaagaagcccaagacccggtttctgggcctcgcgcaagttcctgccaagtacaccccg
gaggtgcagctcatggccggctcgctcaagctcaacggacagcacgaggccctgacgtgc
aaggtgtctacggccggcggggatgccccctggcgggtggaggcgtgcgggggagggcag
cgccgcctggtggcgacccacgccctggggccccagcagcccctgctcgaggtgcgggga
aagttcctgtcggcctcccagttccgccaccagaacccggtgttccacaagcggctgtac
cccttcgtgctgttctaccagccgtgcgcggaggaggagacggtgtgcgtggacgcccgg
gagtacggcaacgaggcccgcttcgtgcgtcgctcctgctgccccaacgtgcaggtgcag
cacgtggtgcacaacggcctgctccacctgtacctggtctcctccagggacattgccccg
gggcaggagctcaccatcccctttgacttcgactaccgtcagtgcatccacagcgtgagc
tgtgcatgtggctccgaggactgtagagtggccagcaagggacgcaaggccgctcctccg
gcggagcgcaagcgtcgtggccgccgggtgagcacgagcagctgcggtctggtcgaggag
gaaccggcgctagccaaggaggcggcgcgactggcgccgcacaacgacgaccagccgtcc
ctgggcgccctggccgaaccgcaggagtgcagtccggcgatggcgtctcccgcctcggac
tcggccacgggccaggagggccaccaaggggcccccgaggaccaggagagcgaggagcag
agctcggcggagcggcggcgcaagatgacgcgggaggagcgcaagatcgacgccatcatg
cgtgcctttgagaagatggagcggacggagaagcggcgccggcaggccctggagcgcatg
gcccagcagcaccgggggggccccaagcacgagcacccgcccttgccggacaagctggag
gacgaacgttccaacgactcctccctgcctgccgcgccgcccgaggaactcaagcccgag
ccccaccctgagggcagcacagaggacagagcggtctctctgcacagggccagaaaggga
aagcggcggcgcagcacggtctcccggcgtcgcagccgtacggtcagcgggggctcggag
cttttggggtctccgccggagtgcgaggcctcgctcgaggctccgcccccttcggcgatg
cactgtccgttgtcccctccctgccaccgggaggaggagccagtgactgcggaggtgcct
gccacgcccccccagggggccgccctgtcgcccggaccgtcgcccacggggaaggccttt
gccctgcccaagtcaaagagggtgatggaggaggcaccctgctacgtgcggtgcacgcgg
gaccccgctccgtcggcggtgggcatctcggcggcccacctccggcgcaacagctgctcc
acctcggcacccacctccggcggctccgcgaaaaagcggtggctgcggcaggccatgttc
gagtcgagtgaggaggtgacggaggacgggggcctggaaggggcgtgccccggcagcccg
cccgcggccggagaggacagctgccagtcggtctcgcctccccccgccggaggtgggtgc
tgccgggacgtcccgcgctgggacgagccctggggccccttgcgaggagggcttgacgca
gacctggtgacccccctgaagaagcggaggctggtgcgggagtcccgggaatccctggac
tccatgacggggggcctgtccccggccacgggggaggcggccgccaccctgctctcgttc
caggcgccctgcctggcggccccctttgcggcccccttccaccgggtggaggtccccccg
gaacagagccccccggggcccccccctgaagaagaggaggaccccccaacccccctggac
gacgaggagagcctggtggactgcgacgagtcgacgacggaggaggcggcggtgccggag
gggccccggctgctgcccccgatcccggtgtccctgccagaccctctggtgatgatggcc
tcccaccaggtgccacccctggacaccacggcagctttgccgccaccagccgccaccgag
gtggtcttcagccacaggatagaggaggtgccggaaaggccccccgaggcggcgcgggtg
gcgaccgcagacgcgccttggagcgggctgcggacagacgcggtggacgtgtcggactgc
tcgactgcctcgtcgtcctcatcgtccctgtgcgcgctgccgccctcttcgcccggctcc
cggcccctggcgtcgtccggaggcatgctcaagcgcaaggtgagcctgtcggagtaccgg
atgcggatgcgggagacaggcaaggcggccggcgtggcctcctgcaagagccccctggga
cccccgggccccccggtgcaggaccgccagggcacgcccctctgctcccctgccaagggt
gaagaagaggacgacccctggggccagccccggcgggagcgactgagccagcggctgcgg
cgggagttcggcctggacgacgactcggactcggagaggaacccccacgccgacggtgcc
cccacactgccaccttcggcggcaggctaccagccgcccctggtgccccacctcggcacc
ctccagcccccgggaactcccaggggcaccccaggtgccgccggaggaaccactcctccg
caaggacggcccccccagggctacttccacagctag

DBGET integrated database retrieval system