KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW020151Help
Entry
IscW_ISCW020151   CDS       T01131                                 

Definition
enhancer of zeste, ezh, putative (EC:2.1.1.43)
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     IscW_ISCW020151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 737 aa AA seqDB search
QAMDVSKVSPEWRKRVRSEYMRLRQIKRFKRHDEVMAAYMTNRRFIIETAALLQKQQTDT
KAVAVFPTDVPLHLPVMKKCEIELADGTKQASPMRIMYAVNPIPTMYTWAPTQQNFMVED
ETVLHNIPYMGDEILDQDGTFIEELLKNYDGKVHGDRDAGSVNDELFLELVHALMTYEDE
PGTTNRTLTEANYYDICWFRTLARRPLRNLFPEKCEEKAPSPSDFIFAAICSVFPDKRTP
EELKERYRELMEKVNPPSVPPECTPNMDGPFAQSVPREQSMHSFRTLFCRRCFKYDCFLH
TFHPAPSQYKRKSCDMKLDTEPCGSHCYLHLVWTDSVKAKLQAKLKEERESTEQRKMQKQ
ISVDSGNEASGEDSNDSTRTNSKKSDSSEKDSDKPAQMTSQIWDVHRAGKSLEGKAARLL
ASLEPVVQPSQEELQEEWSGAEQSLFRVLWRVFYGNYCALATLILTKTCAQASWRFDCMQ
RSSLADLPPEEHVHDSTPPRKKKKKHRLWSMHCRKIQLKKDSSSNHVYNYTPCNHPGQAC
DQNCPCVMAQNFCEKFCHCNSDCQQRFPGCRCKAQCNTKQCPCYLAVRECDPDLCQTCGA
DQFDVQNISCKNVSVQRGLRKVSETAQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFL
FNLNNDFVVDATRKGNKIRFANHSINPNCYAKVMMVNGDHRIGIFAKRHIQSGEELFFDY
RQVQLKFVGIERELEFL
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
caagcaatggatgtgagcaaagtgagtccggaatggaggaaacgagtccgttctgagtac
atgaggctacggcagataaagcgatttaaacgccacgatgaagtgatggcagcatacatg
acgaacagacgattcatcatcgagacagctgcactcttgcaaaaacaacagacagacacc
aaggcggtggctgtgtttcccactgacgtccctcttcacctccccgtcatgaagaagtgc
gaaattgagcttgcagatggtaccaagcaggcgtcacctatgcgaatcatgtatgctgtc
aatcctatcccaacaatgtacacctgggcaccaactcagcagaattttatggtggaagat
gaaacagtgctgcacaacattccctacatgggagatgaaatccttgaccaagatggcaca
tttattgaggaactgcttaaaaattacgacggcaaagttcacggagatcgcgatgcaggc
tctgtgaatgatgagcttttcctagagctcgtccatgctctcatgacctatgaggatgag
ccgggaaccaccaacaggacactcactgaggcaaattactatgatatatgctggttcaga
actttggcaagaaggccccttcgtaatttatttccagagaaatgcgaggaaaaagcacca
tctccatcagacttcatttttgctgcaatttgttcggtgtttccggacaaaaggacccca
gaggagctgaaagaacggtaccgggagttgatggaaaaggtgaatcctccttccgtgcca
cccgaatgcactcccaatatggatggcccatttgcacagtcagtaccgcgtgagcaaagc
atgcattccttccgaacgctcttctgccgacgatgcttcaagtatgactgctttctacac
acattccatccagcaccaagtcagtacaaacggaagagttgcgacatgaagttggacact
gaaccttgtggctcacattgctacttgcatctggtatggacagactctgtgaaggcaaag
cttcaagcgaagctcaaagaagagcgggagtcaactgagcaacgcaaaatgcaaaagcag
atttcagtcgatagcggaaacgaagcaagcggtgaagacagcaatgacagcacacgtacc
aacagtaagaagagtgacagctctgagaaagactcggacaagcctgcccagatgacctca
caaatctgggatgtgcatcgtgcaggcaaatcacttgagggcaaagctgctcggctcttg
gcttcactggagcctgtggttcaaccatctcaggaggaactacaagaagagtggtccggc
gcagagcagtcgctctttcgggttctgtggagagtcttctatggcaactactgtgccctc
gccacacttatcctcaccaaaacatgcgcacaggcaagctggcgttttgactgcatgcaa
cgctcttcactggccgaccttccacctgaagagcatgtgcatgacagcacaccaccacgc
aagaagaagaaaaagcaccggctgtggtccatgcattgccgcaagatccaactcaagaag
gacagctcatccaaccacgtgtacaattacacgccttgcaaccatcctggccaggcctgt
gaccagaactgcccatgcgtcatggctcagaacttttgcgagaagttctgccactgtaac
tctgactgccagcagcggttcccaggatgtcggtgcaaggcccagtgcaacaccaagcag
tgcccttgttacttggcagtcagggagtgtgatcccgacctctgtcaaacatgtggagcg
gatcagtttgatgtgcagaacatttcgtgcaagaatgtaagtgtccagagaggcctccgg
aaggtaagtgagactgctcagaagaacgagttcatctccgagtattgtggagagataatt
tcccaagatgaagctgacagacgtggaaaggtgtatgacaagtacatgtgcagtttcctc
ttcaacctcaacaatgattttgtggtggatgctacacgcaaaggaaacaagatcaggttt
gctaatcactccatcaatcccaactgttatgccaaagtgatgatggtgaatggagaccac
cgcattggaatttttgcaaagcgtcacattcagtccggagaagaattgtttttcgactac
aggcaagtgcagctcaagtttgtgggcattgaacgggaattggagtttttataa

DBGET integrated database retrieval system