KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW020250Help
Entry
IscW_ISCW020250   CDS       T01131                                 

Definition
endonuclease, putative
Orthology
K04799  
flap endonuclease-1 [EC:3.-.-.-]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
DNA replication
Base excision repair
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:isc03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:isc03410]
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:isc03450]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 384 aa AA seqDB search
MGITGLSKVIADNAPSAIKEGDIKSYFGKKIAIDASMCLYQFLIAVRQENNMLTNSDGET
TRYGLPTRAHGLDCTGPVRRGLNVPSVLFIADCKSCNHVRHLCNFVKLNLRCSFSGNQED
INKFSKRLVKVTRQHGEDCKRLLGLMGVPYIEAPCEAEAQCAELVKGGKVYGTATEDMDG
LTFGTNVLLRHMTYSEARKMPIKEFNLERVLSGLELNRDEFIDLCILLGCDYCESIRGIG
PKRAIELIKQHKSIEKIISSIDTKACCDTKYTIPEDWPFKEARQLFLEPEVTPASEIQLK
WTDPDEDGLVKFLCEENGFSEERIRNGAKKLLKGRNTTTQGRLDSFFKVVPSEGPSAKRK
SESKDEQNKKKKGASRGGKFRKGK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgggaattactggtctctctaaagtgatcgcagataatgctccttccgctattaaggaa
ggggacattaagagctacttcggtaagaaaattgccatcgatgcatcaatgtgcttgtat
cagttcctgatagcagtgcggcaagagaacaacatgctcaccaacagtgatggcgaaaca
acaaggtacggactgccgacacgtgcgcatggtctcgactgtactgggcctgtacgacgt
ggtttaaacgtgccttctgtattgttcatagcggattgcaaatcatgcaaccatgtgcga
cacctgtgtaactttgtgaagttgaatttgcggtgctctttctcagggaaccaagaggac
atcaacaaattcagcaagcgtttggtcaaggtgacacggcagcatggcgaagactgcaag
cgcctcttgggcctcatgggagtgccctatattgaagctccgtgcgaagctgaggcgcaa
tgtgctgaactcgtgaaaggcggcaaagtttacggaaccgccaccgaggacatggatgga
ctcacttttggaaccaatgtccttcttcgccacatgacctacagtgaagcaaggaaaatg
cccatcaaagagttcaatcttgagagagtcctgagtggtctggagctgaatcgtgatgag
tttatcgacctgtgcatcctccttggctgcgactactgcgagagcatcagaggaattgga
cccaagcgggccatcgagctgatcaaacagcacaagagcatcgagaaaatcatcagcagc
attgacacaaaggcatgttgcgacacaaaatataccattcccgaagactggcccttcaag
gaagctcgtcagctgtttctggagcctgaagtgacacctgccagtgaaatccagttgaag
tggactgatcctgatgaagatggccttgtgaagttcctctgcgaagagaatggattcagt
gaggaacgtattcgaaacggagccaagaagctactcaagggtagaaatacgaccactcag
ggtcggctggactcgttttttaaggttgtcccctcagaggggccctctgccaaaaggaag
agtgagagcaaggacgaacagaacaagaaaaagaagggtgcctcccgggggggaaagttc
agaaagggcaaataa

DBGET integrated database retrieval system