KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW020250Help
Entry
IscW_ISCW020250   CDS       T01131                                 

Definition
endonuclease, putative
Orthology
K04799  
flap endonuclease-1 [EC:3.-.-.-]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
DNA replication
Base excision repair
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    IscW_ISCW020250
   03410 Base excision repair
    IscW_ISCW020250
   03450 Non-homologous end-joining
    IscW_ISCW020250
Enzymes [BR:isc01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     IscW_ISCW020250
Exosome [BR:isc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   IscW_ISCW020250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 384 aa AA seqDB search
MGITGLSKVIADNAPSAIKEGDIKSYFGKKIAIDASMCLYQFLIAVRQENNMLTNSDGET
TRYGLPTRAHGLDCTGPVRRGLNVPSVLFIADCKSCNHVRHLCNFVKLNLRCSFSGNQED
INKFSKRLVKVTRQHGEDCKRLLGLMGVPYIEAPCEAEAQCAELVKGGKVYGTATEDMDG
LTFGTNVLLRHMTYSEARKMPIKEFNLERVLSGLELNRDEFIDLCILLGCDYCESIRGIG
PKRAIELIKQHKSIEKIISSIDTKACCDTKYTIPEDWPFKEARQLFLEPEVTPASEIQLK
WTDPDEDGLVKFLCEENGFSEERIRNGAKKLLKGRNTTTQGRLDSFFKVVPSEGPSAKRK
SESKDEQNKKKKGASRGGKFRKGK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgggaattactggtctctctaaagtgatcgcagataatgctccttccgctattaaggaa
ggggacattaagagctacttcggtaagaaaattgccatcgatgcatcaatgtgcttgtat
cagttcctgatagcagtgcggcaagagaacaacatgctcaccaacagtgatggcgaaaca
acaaggtacggactgccgacacgtgcgcatggtctcgactgtactgggcctgtacgacgt
ggtttaaacgtgccttctgtattgttcatagcggattgcaaatcatgcaaccatgtgcga
cacctgtgtaactttgtgaagttgaatttgcggtgctctttctcagggaaccaagaggac
atcaacaaattcagcaagcgtttggtcaaggtgacacggcagcatggcgaagactgcaag
cgcctcttgggcctcatgggagtgccctatattgaagctccgtgcgaagctgaggcgcaa
tgtgctgaactcgtgaaaggcggcaaagtttacggaaccgccaccgaggacatggatgga
ctcacttttggaaccaatgtccttcttcgccacatgacctacagtgaagcaaggaaaatg
cccatcaaagagttcaatcttgagagagtcctgagtggtctggagctgaatcgtgatgag
tttatcgacctgtgcatcctccttggctgcgactactgcgagagcatcagaggaattgga
cccaagcgggccatcgagctgatcaaacagcacaagagcatcgagaaaatcatcagcagc
attgacacaaaggcatgttgcgacacaaaatataccattcccgaagactggcccttcaag
gaagctcgtcagctgtttctggagcctgaagtgacacctgccagtgaaatccagttgaag
tggactgatcctgatgaagatggccttgtgaagttcctctgcgaagagaatggattcagt
gaggaacgtattcgaaacggagccaagaagctactcaagggtagaaatacgaccactcag
ggtcggctggactcgttttttaaggttgtcccctcagaggggccctctgccaaaaggaag
agtgagagcaaggacgaacagaacaagaaaaagaagggtgcctcccgggggggaaagttc
agaaagggcaaataa

DBGET integrated database retrieval system