KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW020316Help
Entry
IscW_ISCW020316   CDS       T01131                                 

Definition
(RefSeq) cytochrome P450, putative
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     IscW_ISCW020316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 8032750
NCBI-ProteinID: XP_002400171
VectorBase: ISCW020316
UniProt: B7PXC2
AA seq 686 aa AA seqDB search
MEGPASQEGLLGPEAATRAAIAEEAPMFGLLDVLILLALLGFAIYWLFLRRKKAPSFDPA
AIKTFSIETNIQKTDNSSFIGKMKSTGRNIVVFYGSQTGTAEEFAARLAKEANRFGLKAM
VADPEECEMEDLTKLPEINNSMAIFCMATYGEGDPTDNAQDFYQVVKVLFPQGYTVCCVQ
VFALGNKTYEHFNAMGKYVDKRMEELGATRVFELGQGDDDANIEEDFVTWKERFWNTVCE
NFHLEMSGEDINLRQYQLIVHEDLPDEKVFHGEISRLNSYSTQKMPFDAKNPFLAPVRAH
RELYKGSRSCMHIEISIAGSKIRYDSGDHVAVYPMNDIAIVENLGRMLKVDLDTVITLKN
LDEDSSKKHPFPCPTSYRTALLYYVDITTPPRTHVLKEISEYATDEEEKKKLRLMSSSSD
EGKSLYKQWVLNDCRSVVHILEDLPSARPPLDHLLELMPRLQARYYSISSSPKVHPDTIH
MTAVKVEYETPTKRVNHGVATGWLASKRPDNGTQPRLPVYVRRSQFKLPSRPQVPIIMVG
PGTGLAPFRGFIQERDFMRREGKPIGEVVLYFGCRKRDEDYLYREELEQYLADGTLSKLY
LAFSRDQAEKVYVTHLLRQNKDEVWDLIGQKNGHFYICGDARNMARDVHEILVEIFCENG
NMTQEEAAAYLKRMESQRRYSADVWS
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggagggaccagccagccaagaggggctgctcggcccggaagcggccacaagggcagcc
attgcagaggaggcccccatgtttggcctgctggacgtgctcatactgctggcgctcttg
gggtttgccatctactggctgttcctgagacgcaagaaggcaccctcctttgatccagca
gccatcaagacgttctccatagagacaaacatccagaaaactgacaactccagcttcata
ggaaagatgaagtctacgggccgaaacatagtcgttttttacggctctcagactggcaca
gctgaagagtttgcagcgcgtttggccaaggaagccaaccggttcgggctgaaggccatg
gtggctgacccagaagagtgcgagatggaggacctgaccaagctgcccgagatcaacaac
tcaatggccatcttctgcatggcgacgtacggggagggagaccccacggacaacgcccag
gacttctaccaggttgtaaaagttttgtttcctcaaggctacaccgtgtgctgtgtgcag
gtgtttgccctgggaaacaagacgtacgagcacttcaatgctatggggaaatatgtggac
aaaaggatggaagaacttggagcaacacgcgtctttgaactcgggcagggcgacgacgat
gccaacattgaggaggactttgtgacgtggaaggagcgcttctggaacacggtgtgcgag
aacttccacctggagatgtccggggaggacatcaacttgcgccagtaccagctcatagtg
cacgaggacctgccggatgagaaggtcttccacggcgagatctcgcgcctcaactcctac
tccacccagaagatgcccttcgacgcaaagaacccattcctggctcccgtccgtgcacac
agggagctgtacaagggttcccggtcgtgcatgcacattgagatcagcattgcaggctct
aaaatcagatacgattctggcgaccacgtggccgtctacccgatgaacgacattgccatt
gtggagaacctgggccggatgctcaaggtggacctggacaccgtcatcactctcaagaac
ctggatgaggacagctccaagaagcaccccttcccatgccccaccagctaccgcacagcc
ctgctgtattacgtggacatcaccactccgcccaggacccacgtgttgaaggaaatttct
gagtatgccaccgacgaggaggagaagaagaagctccggctcatgagctcctcctccgac
gagggcaagagcctgtacaagcagtgggtgctcaacgactgccgcagcgtagtgcacatt
ttggaagacctgccatcggcccgtccaccgctggaccacctcctagagctgatgcccagg
ctgcaggctcgctactactccatctcttcttcgcccaaggtgcatccggacacgatccac
atgacggcggtgaaggtggagtatgagactccgacgaagcgggtgaaccacggggtggcg
acgggctggctggccagtaagcgcccagacaacggcacccagccccggctgccggtgtat
gtgcgccgctcccagttcaagctgccctctcggccccaggtgcccatcatcatggtgggg
cccggcacgggcctggcccccttcaggggcttcatccaggagagggacttcatgcgccgt
gagggcaagcccattggggaggtggtgctgtactttggctgccgcaagcgggacgaagac
tacctgtaccgggaggagctggagcagtacctggcggacggcaccctgagcaagctgtac
ctggccttctccagggaccaggccgagaaggtgtatgtgacgcacctgctgcgccagaac
aaggacgaggtctgggacctcattggtcagaagaacggccacttctacatctgcggggat
gcgcgcaacatggcgagggacgtgcacgagatcctggtcgagatattctgcgagaacggc
aacatgacgcaggaggaggcggcggcctacctcaagcggatggagtcgcagcgccgctac
tcagccgacgtctggagttga

DBGET integrated database retrieval system