KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW020499Help
Entry
IscW_ISCW020499   CDS       T01131                                 

Definition
prohormone convertase, putative (EC:3.4.21.94)
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     IscW_ISCW020499
Peptidases [BR:isc01002]
 Serine Peptidases
  Family S8: subtilisin family
   IscW_ISCW020499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 430 aa AA seqDB search
HGTRCAGEVSAKRDNGVCGVGVAYDSKVAGIRMLDQPYMTDLIEANSMGHEPNLIDIYSA
SWGPTDDGKTVDGPRNATMRAIVRGVNEGRHGLGNIYVWASGDGGEDDDCNCDGYAASMW
TVSINSAINNGENAHYDESCSSTLASTFSNGAKDPHTGVATTDLYGKCTKTHSGTSAAAP
EAAGVFALALEANPTLTWRDIQHLTVLTSKRNSLYDSKNRFHWKMNGVGLEFNHLFGYGV
LDAGAMVALAKIWKTVPPRYHCEAGSYLKTSEFRTNNSLKIFIDTDSCAGTVTEVNYVEH
VQAVITLNATRRGDVKLFMVSPSGTRSMILSRRPNDDDRHDGFTKWPFMTTHTWGENPRG
RWSLEARIEGADPSKSDPKARGFLREWTLMVHGTRDPPYVDLPAHDSNSKLAIVKKAHET
TQRGGKAPRP
NT seq 1294 nt NT seq  +upstreamnt  +downstreamnt
tcatggaacacgatgcgctggagaagtgtcagcaaagcgagacaacggagtttgcggcgt
gggtgttgcctacgattccaaggtggctggtatccgcatgctggaccagccttacatgac
agacctgatcgaggccaactcgatgggccacgaaccgaacctgatcgacatctacagcgc
ctcctggggaccgacagacgacggcaagaccgtcgacgggccgaggaacgccaccatgcg
cgccatcgtcaggggagtcaacgagggccgacacggcctcggcaacatctacgtgtgggc
gtccggcgacggcggcgaggacgacgactgcaactgcgacggctacgcggcatccatgtg
gacggtgtccatcaactcggccatcaacaacggcgagaacgctcactacgacgagtcctg
ctcgtccaccctcgcgtccaccttcagcaacggggccaaggacccgcacacgggcgtcgc
cacgacggacctgtacggaaagtgcaccaagacccactccggaacgtcggccgccgcccc
tgaggccgcgggtgtcttcgccctcgccctcgaggccaacccgacgctgacttggaggga
catccagcacctgaccgtgctcacctcaaagaggaactcgctatacgatagcaagaaccg
cttccactggaagatgaacggagtgggtctcgagttcaaccacctgttcggctacggggt
cctcgacgctggggccatggtggccctggccaagatctggaagacggtgccgcccaggta
ccactgcgaggccggatcttaccttaagaccagcgagttccgaaccaataacagcctgaa
gattttcattgacacggactcgtgcgctggcactgtgaccgaagtgaactacgtggagca
cgtgcaagccgtcatcacgctgaacgccaccaggaggggcgacgtcaagctcttcatggt
gtctccgtctggcacaaggtcgatgattctgagccggcgtcccaacgacgacgaccgcca
cgacggcttcaccaagtggcccttcatgaccacccacacctggggcgagaaccccagggg
ccgctggagcctcgaggcccggatcgagggcgcggacccttccaagagcgaccccaaggc
acggggcttcctccgggagtggaccctcatggtccacggcaccagggacccgccgtacgt
cgaccttccggcccacgacagcaactccaagctggccatcgtcaagaaggcccacgagac
aacacaacgcggcggcaaagcgcccaggccgtag

DBGET integrated database retrieval system