KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW020515Help
Entry
IscW_ISCW020515   CDS       T01131                                 

Definition
glutaminase, putative (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    IscW_ISCW020515
   00330 Arginine and proline metabolism
    IscW_ISCW020515
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    IscW_ISCW020515
Enzymes [BR:isc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     IscW_ISCW020515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 492 aa AA seqDB search
VNVDDLLFDMFKDSDGTVCVGKFLNALFTTGLWKNDPRLKEMMQNLRNVHKEKSPVRSLE
NLSVTRETFSQVIRENIVLITRALRHQFVIPDFQDFVRYVEDFYWKCKVNTGGKVATYIP
QLAKYNPDYWGVSICTVDGQRFSIGDTEIPFTIQSSGKPINYAIALTELGSDTVHQYVGQ
EPSGRMFNELVLDYNKKPHNPMVNAGAIVVASLLLYLIEPEMRTSEKFDWMLQYYRAISG
GEYLGFNNAIFLSEREAADRNYAIGFYMKENKCFPERVNLKETMDFYFQLCSLEVNCQSV
SVMAATLANGGICPVTGHQVMNGVSCRDVLSLMHSCGMYDYSGHMLSFFVGLPAKSGVSG
CTMVVVPNVMGFCLWSPPLDIYGNSVRGVQFCEELTRVFSFHHYDNLRHMTQKKDPRRQK
YETKGQKIVNLLFSAASGDVTAMRRFIHAFDITYGDYDGRTALHLAAAEGHLECVEFLLK
MCGVDANIKDRW
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtggacgatctgctctttgacatgttcaaggatagcgacggaactgtctgcgtg
ggaaaatttttaaatgctctcttcactactggcctgtggaaaaacgatccacggctcaag
gagatgatgcagaacttacgaaatgttcacaaggagaagtccccagttcgttcgctcgag
aacctctctgtcaccagggaaactttcagccaggtgattcgtgaaaatattgtgctgatc
acacgagccctgcgtcatcagttcgtgataccggactttcaagactttgtgcgctatgtc
gaggacttctactggaaatgcaaggtcaacaccggtgggaaggtagctacatacatccct
cagttggccaagtacaaccccgactattggggagtcagcatctgtacagtggacggacaa
aggttttcgatcggggacacggagattccgttcacgattcagtcgtctggcaagccgatc
aactatgccattgcgctcacggagctgggttcggatacggtgcaccagtacgtggggcag
gaacccagcgggaggatgttcaacgaactggtcttggactacaacaagaagccccacaac
cccatggtgaatgctggcgctattgtggtggcctcccttcttctctacctcattgagcca
gaaatgaggacatccgagaagtttgactggatgctgcagtattacagagcaatctcggga
ggagagtacctggggtttaacaatgccatattcctgtctgagagggaggcggcagaccgc
aactatgccattggcttctacatgaaggagaacaagtgctttccggagagggtcaacctc
aaggagaccatggacttttactttcagctgtgctcgctggaagtgaactgccagtcggtg
agcgtgatggcagcgaccctggccaatgggggcatctgtccggtcacgggacaccaggtg
atgaacggcgtgtcctgcagggatgtcctgtccctcatgcactcctgcggcatgtatgac
tactcgggacacatgctcagtttttttgtcggccttccagccaagtccggcgtctctggc
tgcaccatggtggtggttcccaatgtgatgggcttttgcctctggtcgccccctctcgac
atctacgggaactctgtccggggcgtgcagttctgcgaggaactgacgcgggtgttcagc
ttccaccactacgacaacctgcgtcacatgacccagaagaaggacccgcggaggcagaag
tacgagaccaaagggcagaagatcgtcaacctgctgttcagcgcggccagcggtgacgtc
accgccatgcgccggttcatccatgcttttgacataacttatggcgactacgacggccgc
accgccctccacttggcggcggccgagggacacctggagtgcgtggagtttctcctcaag
atgtgcggagtggacgccaacatcaaggacaggtgg

DBGET integrated database retrieval system