KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW020571Help
Entry
IscW_ISCW020571   CDS       T01131                                 

Definition
glutathione peroxidase, putative (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    IscW_ISCW020571
  Metabolism of other amino acids
   00480 Glutathione metabolism
    IscW_ISCW020571
Enzymes [BR:isc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     IscW_ISCW020571
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 123 aa AA seqDB search
MLRDATSPLRRQEPGTRQEILNGIKYVRPGNNYVPNFPMFQKIEVNGENQHPLYTFLKGR
CTSPNPVFSPKDKLFYSPQNNNDIRWNFEKFLVDRRGVPVKRYEPRYSPDEVARDIEVLT
RSS
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgctcagggacgcgacctcgccccttcgacgacaagagcccggtacccgccaggagatt
ctgaacgggatcaagtacgtgcgtccgggcaacaactacgtgcccaactttcccatgttc
cagaagatcgaggtgaacggggaaaaccagcacccgctctacactttcctcaagggtcgt
tgcacctcgccaaatccggttttcagccccaaggataaactcttctactcgccccagaac
aacaacgacatccgttggaacttcgagaagtttctggttgacaggcgaggagtgccggtg
aaacgctacgagccccgctactcgcccgacgaggtcgctcgcgacatcgaggtcctcaca
agatcgagctag

DBGET integrated database retrieval system