KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW020577Help
Entry
IscW_ISCW020577   CDS       T01131                                 

Definition
Jun-N-terminal kinase, putative (EC:2.7.11.24)
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:isc04141]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:isc04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:isc04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 411 aa AA seqDB search
MSKHSSLFYTFEVNDTKFTILRRYQNLKSIGSGAQGIVCAAYDSVTGHNVAIKKLSRPFQ
NVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQKTLEEFQDVYLVMELMDANLCQVIQMD
LDHERMSYLLYQMLCGIKHLHLAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMM
TPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIRGAVLFPGTDHIDQWNKIIEQLG
TPSQEFMRRLQPTVRNYVENRPRYAGYPFDKLFPDVLFPSDSPEHSKLKASQARDLLSKM
LVIDPERRISVDDALAHPYINVWFDETEVNAPAPAAYDHSVDEREHTVEQWKELIYKEVL
EYEQTHNSIGTSGRNALHGSQDGAIEAEAGLSTDQSANGAANSYQRRRYQS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcactccagcctcttctacacctttgaagtgaacgacaccaagtttaccatc
ctgaggaggtaccagaacctcaagtccatcggctcaggcgcacagggcattgtctgtgcg
gcctatgactccgtgactggtcacaatgtggccatcaagaagttgagccgacccttccag
aatgtgacccatgccaagcgggcctaccgcgagttcaaactcatgaagctggttaaccat
aaaaatatcataggtcttctaaatgcattcacaccacaaaagacgctagaagagttccaa
gacgtgtacttggtgatggagctgatggatgccaacctgtgccaggtgatccagatggac
ctggatcacgagcgcatgtcctacctgctctaccagatgctctgtggcatcaagcaccta
cacttggctggcattatccacagggacctgaaaccgagcaacatagtggtgaaatcagat
tgcacgctcaagatcctggactttggactggctcgcacagccggcaccagtttcatgatg
accccctacgtggtgacccgctactacagggccccagaggtcatcttaggcatgggctac
aaggaaaatgtggacatctggtcggtcggctgcatcatgggggagatgatccgaggtgcg
gtgctctttccgggcacggaccacattgaccagtggaacaagatcattgagcagctgggc
accccgtcccaggagttcatgcggcgcctgcagcccacagtgcgcaactatgtggaaaac
cgtccccggtatgcaggctaccccttcgacaagctcttcccggacgtcctcttccccagc
gacagccccgagcacagtaagctcaaggcgagccaggcgcgcgacctcctgtcgaagatg
ctcgtgatcgatcccgagaggcgcatctcggtggacgacgccttggcccacccatacatc
aacgtatggttcgacgagactgaagtgaacgcgccagccccggcggcttacgaccactcg
gtagacgagcgggaacacacggtggaacagtggaaggagctgatctacaaggaagtgctt
gagtatgagcagacgcacaacagcataggcacgtccggccgcaacgccctccacggctct
caagatggtgcaatagaagcggaggctggcctgtccacggaccagtctgccaacggggcg
gccaacagctaccagcggcggcgctaccagtcctag

DBGET integrated database retrieval system