KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW020596Help
Entry
IscW_ISCW020596   CDS       T01131                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase, putative (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    IscW_ISCW020596
   00052 Galactose metabolism
    IscW_ISCW020596
   00500 Starch and sucrose metabolism
    IscW_ISCW020596
   00520 Amino sugar and nucleotide sugar metabolism
    IscW_ISCW020596
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     IscW_ISCW020596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 508 aa AA seqDB search
RGCSCLQMFGHSRKQSDSTEFKEMSKVDAQTHLAQELEKLCLTASAAERELVETEFRGFQ
KLFQKFLKDTGPSVNWEHIQPLPADAVIDYGLLQPPPDDDTIRNMLNKLVVVKLNGGLGT
SMGCKGPKSVIPVRNDLTFLDMTVQQMEHLNRTYNSAMPLVLMNSFNTDEDTSKVLRKYK
GFRVKIYTFLQSRYPRINRETLMPVASTLINPDPEAFYPPGHGDFYTSFCQSGLLEHFLS
EGREFCFISNIDNLGATVDLNILNLLLSTNTPTAPDFVMEVTDKTRADVKGGTLIQYENR
LRLLEIAQVPKENIDEFKSIKKFKIFNTNNLWMKLSTMSELVQSNGIDMEVIVNHKTLDT
GVNVVQLETAAGAAMKDFSKAIGINVPRSRFLPVKKTSDLLLVMSNLYHMKFGTLVMSPK
RTFPTVPLIKLGDNHFAKVREFLQRFASIPDILELDHLTVSGDVTFGKGVSLRGTVIIIA
NHGDRIDIPASAVLENKIVSGNLRILDH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
cgtggctgttcttgcttgcagatgtttgggcacagccgtaagcagagcgacagcaccgag
tttaaggagatgtcgaaggtggatgctcagacccacctggcccaagagctggagaagctc
tgtctcacagccagcgccgcagaacgagagctcgtggagacagagtttcgaggcttccag
aagctcttccagaaattcctcaaggacacgggaccctccgtgaactgggagcacatccag
cccctgcctgccgacgcggtgattgactacggcctgctgcagccgccgccggacgacgac
accatccgcaacatgctgaataagctggtggtggtgaagctcaacggcggtctgggcacc
agcatggggtgcaagggccccaagtccgtcatcccggtccgaaacgacctcacctttctc
gacatgacagtgcagcagatggagcacctcaatcggacgtacaactctgccatgcccctg
gtgctgatgaattcgttcaacacggacgaagacacgtccaaggtgctgcgcaagtacaag
ggattccgtgtcaagatctacactttcctccagagcaggtacccgagaatcaacagggag
acgctgatgcccgttgcctccaccctcatcaacccagacccagaagcgttctaccctccc
ggccacggggacttctacacgtctttctgccagtcggggctcctagagcacttcctgtcg
gaggggcgggagttctgcttcatctccaacattgacaacctcggggccaccgtagacctc
aacattctcaacctgcttctctccacgaacaccccaacggcccccgacttcgtgatggag
gtgaccgacaagacgagggcggacgtcaagggaggaaccctcatccagtacgaaaaccga
ctcaggctgttggaaattgctcaagtgcccaaagaaaacatagacgagttcaagagcata
aagaagttcaagatcttcaacaccaacaacctgtggatgaagctgagcaccatgtcagag
ctggtgcagtccaatggcatcgacatggaggtcatagtgaaccacaagacactcgatacg
ggggtgaacgtggtccagcttgagactgcagcgggggcagctatgaaggacttctccaaa
gccatcggcatcaacgtgccccggagccgcttccttccggtgaagaagacctccgacctg
ctgctggtgatgagcaacctgtaccacatgaagttcggcaccctggtcatgtcccccaag
cgcaccttccccaccgtgcccctcatcaagctgggggacaaccactttgcaaaggtgcgg
gagttcctccagcgctttgcgagcataccggacatcttggagttggaccacctgacggta
tccggcgacgtcacctttgggaagggggtctctctgaggggcaccgtgatcatcattgcc
aaccacggggaccgcatcgacatacctgcgtccgccgtgttggagaacaagattgtttcc
ggcaacctgcgcatcttggaccactga

DBGET integrated database retrieval system