KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW020596Help
Entry
IscW_ISCW020596   CDS       T01131                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase, putative (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:isc00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:isc00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:isc00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:isc00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 508 aa AA seqDB search
RGCSCLQMFGHSRKQSDSTEFKEMSKVDAQTHLAQELEKLCLTASAAERELVETEFRGFQ
KLFQKFLKDTGPSVNWEHIQPLPADAVIDYGLLQPPPDDDTIRNMLNKLVVVKLNGGLGT
SMGCKGPKSVIPVRNDLTFLDMTVQQMEHLNRTYNSAMPLVLMNSFNTDEDTSKVLRKYK
GFRVKIYTFLQSRYPRINRETLMPVASTLINPDPEAFYPPGHGDFYTSFCQSGLLEHFLS
EGREFCFISNIDNLGATVDLNILNLLLSTNTPTAPDFVMEVTDKTRADVKGGTLIQYENR
LRLLEIAQVPKENIDEFKSIKKFKIFNTNNLWMKLSTMSELVQSNGIDMEVIVNHKTLDT
GVNVVQLETAAGAAMKDFSKAIGINVPRSRFLPVKKTSDLLLVMSNLYHMKFGTLVMSPK
RTFPTVPLIKLGDNHFAKVREFLQRFASIPDILELDHLTVSGDVTFGKGVSLRGTVIIIA
NHGDRIDIPASAVLENKIVSGNLRILDH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
cgtggctgttcttgcttgcagatgtttgggcacagccgtaagcagagcgacagcaccgag
tttaaggagatgtcgaaggtggatgctcagacccacctggcccaagagctggagaagctc
tgtctcacagccagcgccgcagaacgagagctcgtggagacagagtttcgaggcttccag
aagctcttccagaaattcctcaaggacacgggaccctccgtgaactgggagcacatccag
cccctgcctgccgacgcggtgattgactacggcctgctgcagccgccgccggacgacgac
accatccgcaacatgctgaataagctggtggtggtgaagctcaacggcggtctgggcacc
agcatggggtgcaagggccccaagtccgtcatcccggtccgaaacgacctcacctttctc
gacatgacagtgcagcagatggagcacctcaatcggacgtacaactctgccatgcccctg
gtgctgatgaattcgttcaacacggacgaagacacgtccaaggtgctgcgcaagtacaag
ggattccgtgtcaagatctacactttcctccagagcaggtacccgagaatcaacagggag
acgctgatgcccgttgcctccaccctcatcaacccagacccagaagcgttctaccctccc
ggccacggggacttctacacgtctttctgccagtcggggctcctagagcacttcctgtcg
gaggggcgggagttctgcttcatctccaacattgacaacctcggggccaccgtagacctc
aacattctcaacctgcttctctccacgaacaccccaacggcccccgacttcgtgatggag
gtgaccgacaagacgagggcggacgtcaagggaggaaccctcatccagtacgaaaaccga
ctcaggctgttggaaattgctcaagtgcccaaagaaaacatagacgagttcaagagcata
aagaagttcaagatcttcaacaccaacaacctgtggatgaagctgagcaccatgtcagag
ctggtgcagtccaatggcatcgacatggaggtcatagtgaaccacaagacactcgatacg
ggggtgaacgtggtccagcttgagactgcagcgggggcagctatgaaggacttctccaaa
gccatcggcatcaacgtgccccggagccgcttccttccggtgaagaagacctccgacctg
ctgctggtgatgagcaacctgtaccacatgaagttcggcaccctggtcatgtcccccaag
cgcaccttccccaccgtgcccctcatcaagctgggggacaaccactttgcaaaggtgcgg
gagttcctccagcgctttgcgagcataccggacatcttggagttggaccacctgacggta
tccggcgacgtcacctttgggaagggggtctctctgaggggcaccgtgatcatcattgcc
aaccacggggaccgcatcgacatacctgcgtccgccgtgttggagaacaagattgtttcc
ggcaacctgcgcatcttggaccactga

DBGET integrated database retrieval system