KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW020654Help
Entry
IscW_ISCW020654   CDS       T01131                                 

Definition
hypothetical protein
Organism
isc  Ixodes scapularis (black-legged tick)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 90 aa AA seqDB search
MILVKELRRDSSFREAWSEAQDLYPEKHLLGGDVMDEESYLAVISYTLETPNVCKEFNAL
CREAEAAEWSWEIFPFKSLWYFLIRAFEKL
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgtgaaggaacttcgacgggattcgtcgttccgggaagcatggagcgaggcc
caggacctctatccggagaaacatttgctcggaggcgacgtcatggatgaagaatcctat
ttagcggtcatctcttacaccctggagactcccaacgtatgtaaggagttcaatgccttg
tgtcgcgaagctgaagctgcggagtggagttgggagatattcccatttaagagcctgtgg
tatttcctcatccgggcattcgaaaagctatag

DBGET integrated database retrieval system