KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW020654Help
Entry
IscW_ISCW020654   CDS       T01131                                 

Definition
hypothetical protein
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     IscW_ISCW020654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 90 aa AA seqDB search
MILVKELRRDSSFREAWSEAQDLYPEKHLLGGDVMDEESYLAVISYTLETPNVCKEFNAL
CREAEAAEWSWEIFPFKSLWYFLIRAFEKL
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgtgaaggaacttcgacgggattcgtcgttccgggaagcatggagcgaggcc
caggacctctatccggagaaacatttgctcggaggcgacgtcatggatgaagaatcctat
ttagcggtcatctcttacaccctggagactcccaacgtatgtaaggagttcaatgccttg
tgtcgcgaagctgaagctgcggagtggagttgggagatattcccatttaagagcctgtgg
tatttcctcatccgggcattcgaaaagctatag

DBGET integrated database retrieval system