KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW020654Help
Entry
IscW_ISCW020654   CDS       T01131                                 

Definition
(RefSeq) hypothetical protein
  KO
K19977  ADP-ribosyltransferase 5 [EC:2.4.2.31]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     IscW_ISCW020654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ART
Motif
Other DBs
NCBI-GeneID: 8035004
NCBI-ProteinID: XP_002410927
VectorBase: ISCW020654
UniProt: B7Q2P7
AA seq 90 aa AA seqDB search
MILVKELRRDSSFREAWSEAQDLYPEKHLLGGDVMDEESYLAVISYTLETPNVCKEFNAL
CREAEAAEWSWEIFPFKSLWYFLIRAFEKL
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgtgaaggaacttcgacgggattcgtcgttccgggaagcatggagcgaggcc
caggacctctatccggagaaacatttgctcggaggcgacgtcatggatgaagaatcctat
ttagcggtcatctcttacaccctggagactcccaacgtatgtaaggagttcaatgccttg
tgtcgcgaagctgaagctgcggagtggagttgggagatattcccatttaagagcctgtgg
tatttcctcatccgggcattcgaaaagctatag

DBGET integrated database retrieval system