KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW020926Help
Entry
IscW_ISCW020926   CDS       T01131                                 

Definition
myst histone acetyltransferase, putative (EC:2.3.1.48)
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     IscW_ISCW020926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 441 aa AA seqDB search
TKDDMSFQSEGNNNATKSYSSSERSRNRENSDSMMEGALEIGEHYMVRRCDETWHPAEII
QVRPCDQDVGKWEYYVHYEGYNRRLDEWVDRDRFNLSSSQKEEMKNPMTQGDCIEQSDRK
ITRNQKRRHDEINHIQKTYAEMDPTTAALEKEHEAITKVKYVDRIQFGKYEIDAWYFSPF
PEEYGKVPKLWMCEYCLKYMKLEKTYRYHMSECTWRQPPGKEIYRRGTVSLWEVDGREHK
IYCQNLCLLAKLFLDHKTLYFDVEPFLLYVLCEVDKQGSHLVGYFSKEKDSPDGNNVACI
LTLPPYQRKGYGKFLIAFSYELSKMEGTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFR
GTLSIKDLSQMTSITQNDIVTTLQSLNMVKYWKGQHVICVTPKLVEEHLRSAQYKKPRLS
VDISCLRWTPPKKRPKPGKKL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
acgaaagatgacatgtccttccagtcggagggaaacaacaacgcaaccaaatcttacagt
tcatcggaaagaagcagaaatcgagaaaattctgactcgatgatggagggagcgctagaa
atcggagaacactacatggtccgccgctgcgacgaaacttggcaccccgcggaaattatt
caagttcggccctgcgaccaagatgtcggaaaatgggagtactacgttcactacgagggc
tacaaccgtcgcttggacgagtgggtggacagagaccgcttcaacctgtcttcgtcgcaa
aaggaggaaatgaagaacccgatgacgcagggtgactgcatcgagcagtccgacaggaag
atcaccagaaaccagaagaggcgccacgacgagatcaaccatatccagaagacgtacgct
gaaatggaccccacaacagcagcattggagaaggagcacgaagctataacaaaggtgaag
tacgtcgaccggatccagttcggcaagtacgagatcgacgcctggtacttctccccgttt
cccgaggagtatggcaaggtacccaaactttggatgtgcgagtactgcctcaagtatatg
aaactcgagaagacataccgctaccacatgagcgagtgcacatggagacagcctcctggg
aaggagatctacaggagagggaccgtctcgctttgggaggttgatggccgggaacacaag
atctactgccagaacctgtgcctgctggccaagctgttcctggaccacaagacgctgtac
ttcgacgtggagcccttcctgctgtatgtgctgtgtgaggtggacaagcagggctcccac
ctggtgggctatttctccaaagagaaggactccccagatgggaacaacgtcgcctgcatc
ctcaccctgcccccataccagcgcaagggctacggcaagttcctcatcgccttcagctac
gaactgtccaagatggaaggcacagtgggctctcccgaaaagccactctccgacttgggc
aagctgagctatcggagctactggtcctgggtgctgctggaaatcctcagggacttcagg
ggcacgctctccatcaaggatctcagccagatgacaagcatcacgcagaacgacatagtg
acaacgctgcagagcctcaacatggtcaagtactggaaggggcagcacgtcatctgcgtg
acccccaaactggtcgaagagcacttgcggagcgcccagtacaagaagccccgcctctca
gtggacatctcctgcctccgctggaccccgcccaagaagcggcccaagccgggcaagaag
ctctaa

DBGET integrated database retrieval system