KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW021213Help
Entry
IscW_ISCW021213   CDS       T01131                                 

Definition
(RefSeq) translation initiation factor 4F, cap-binding subunit, putative
  KO
K03259  
translation initiation factor 4E
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    IscW_ISCW021213
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    IscW_ISCW021213
Messenger RNA biogenesis [BR:isc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     IscW_ISCW021213
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     IscW_ISCW021213
Translation factors [BR:isc03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    IscW_ISCW021213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 210 aa AA seqDB search
MAAEDKYSESDSASGEQGGEPLGCDILMKHPLQHRWSLWFYKNDKNRSWEENLLEITSFD
TVEDFWALYNHIEVASKLPLGCDYSLFKHGIKPMWEDSRNKSGGRWLFNLNKNQRTADLD
NYWLEILLCLIGEGFDEFSDDVCGAVVQIRAKLDKIAVWTADVRHAEANIKIGKVLKERI
NLHPRVIVPFQAHADTQSKQGSTARARYQV
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggaagacaaatattccgagagtgactcggcttcgggcgagcagggcggggag
cccctggggtgtgacatcctgatgaagcacccgctgcagcaccggtggagcctctggttc
tacaaaaacgacaagaaccgcagctgggaggagaacctgctggagatcacctccttcgac
acagtggaggacttctgggcactctacaatcacatcgaggtggccagcaagctgccccta
ggctgtgactactccctcttcaagcacggcatcaagcccatgtgggaagactcgcggaac
aagtccggagggcgctggctcttcaacctgaacaagaaccagaggacagcagacctggac
aactactggctggaaattctgctgtgcctgattggagagggcttcgacgagttcagcgac
gacgtgtgcggcgccgtggtccagatcagggccaagctggacaagattgccgtgtggacg
gcggacgtgcgccatgcagaggccaacatcaagattggcaaagttttgaaggagaggata
aacttgcaccctcgagtcatcgttccatttcaagctcatgctgacacccagtctaaacaa
ggatccacggcaagggctagatatcaagtttaa

DBGET integrated database retrieval system