KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW021232Help
Entry
IscW_ISCW021232   CDS       T01131                                 

Definition
NADH-cytochrome B5 reductase, putative (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    IscW_ISCW021232
Enzymes [BR:isc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     IscW_ISCW021232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 298 aa AA seqDB search
MSLVILLSGIGAAVAAALIFRYMRSRAEALRLLLDPDTKYTVPLIEKEEISHDTRRFRFG
LPSPEYVLGLPTGQHIYLVATVNGQLVPRPYTPVTSDQHHGYFDLVVKVYFKNVQPKFPE
GGKMSQHLDAMQIGDTIQVRGPSGLIRYQGRGTFAIKPDKKSAPAPYRAAEIAMIAGGTG
ITPMLQIVRHVFNDPLDKTRCSLIFANQTEDDILLRPELEQVAKEHPDRFRLFFTVDRAK
DGWTQGVGFVSADMIAKNFPPPSDDTVVLMCGPPPMVNFACKPNLEKLGYSAQRCFAY
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcgtcatcctgctgagcggaatcggcgctgccgtggcggcagccctcatcttt
cggtacatgcgaagccgcgccgaagcgcttcggctcctgctcgatcccgacaccaaatac
acggtgccgctgatcgagaaagaagagatcagccacgacacccgacgtttccgcttcggt
cttccgtcgcccgagtacgtcttgggactgcccaccggtcaacacatctatttggtggcc
acggtgaacggacagctcgtgccgaggccctacacgcccgtgaccagcgaccagcaccac
ggttacttcgacctcgtagtcaaggtgtacttcaagaacgtgcaacccaagttccccgag
ggcggcaagatgtcccagcacctggacgccatgcagataggggacaccatccaggtgcgg
ggtccatcggggctcatccgctaccagggccggggtaccttcgccatcaagccggacaag
aagtcggccccagccccgtaccgggccgccgagatcgccatgatcgccggcggcacgggc
atcactcccatgctgcagattgtgcgccacgtgttcaacgacccgctggacaagacccgc
tgctcgttgatcttcgccaaccagacggaagacgacatcctgctgcggccagagctggag
caggtggctaaggagcacccagatcgcttccggctcttcttcactgtggaccgggccaag
gacggctggacgcagggtgtgggctttgtcagcgccgacatgatcgccaagaacttcccg
ccaccgtcggacgacaccgtggtgctcatgtgcggtccgccgcccatggtcaactttgcc
tgcaagcccaaccttgagaagctgggttacagtgctcagcgatgctttgcctactag

DBGET integrated database retrieval system