KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW021418Help
Entry
IscW_ISCW021418   CDS       T01131                                 

Definition
dehydrogenase, putative (EC:1.1.1.105)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:isc00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:isc00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 349 aa AA seqDB search
MLGSLEFFTRIVAAVYSFFFAPDCGIFRDVRFTGHGKRVLVSGCDSGIGLRTAERLHKAG
YQVLAGCLSDQSDGARKLSLLKGPHPVVVLQLDITKQDSVREALKKAEVQEKVFLYMFTG
LWGLVNNAGVCVLGEFEWMTQEQVENTFGVNVLGTLRLSKACLPYIRKSKGRLVTITTVM
AVSSFPGMSVYCASKFALETFCDVLRIELSRHGAYASVIRPGDLVKHTRILEAQKSHAQD
MWNAMDSEQQSLYEPYMAAFISGRANSGGMLGTEALDDSPVFGHIEHALGAARPRARYMS
DKSLWPVFLRFLALLPTTLSDALQSLCYRVIFLHYGSQFAEKSTTEKVR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgttgggaagcctggagtttttcacgaggatcgtggctgcggtctacagcttcttcttc
gctccggactgtggcatcttcagggacgtccgctttaccggacacggcaagagagtgctg
gtcagtggctgtgactccggcatcggactccgaactgccgagcggctccacaaggcgggt
taccaagtgctggccggatgcttgtctgaccagagcgatggagccaggaagctgtccctg
ctgaaaggtccacatcctgtggtcgtgctccagttggacatcacgaagcaagacagcgtt
cgggaagcgctcaagaaggcggaagttcaggagaaagtttttctttatatgtttacagga
ctttggggtttggtgaacaacgccggagtctgcgtgctgggcgagtttgagtggatgaca
caggagcaagtcgaaaataccttcggggtcaacgttttgggaactctgcgactgtccaaa
gcctgcctgccttacatccgcaaaagcaaaggacgactggtgaccatcacgaccgtgatg
gccgtgtccagtttccccggaatgagcgtctactgcgccagcaagtttgccctggagacc
ttctgcgatgtcctcagaatagaactgtccaggcatggcgcctacgccagtgtcatccga
ccgggagaccttgtcaagcacaccaggattctggaggctcaaaagtcacacgctcaggac
atgtggaacgccatggacagcgaacagcagagcctctacgagccctacatggcggccttc
atcagcggtcgtgccaacagcggaggcatgctgggcaccgaagcgctggacgactctccg
gtcttcggccacatcgaacacgcgctgggagcggcccgaccgcgggcccgctacatgagc
gacaagagcctgtggccagtcttcctgcggttcctggccctcctacccaccaccctgtcg
gatgccctccagtccctctgctaccgcgtcatcttcctccactacggctcccagttcgcc
gagaaatctacgacggagaaagttcgataa

DBGET integrated database retrieval system