KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW021418Help
Entry
IscW_ISCW021418   CDS       T01131                                 

Definition
dehydrogenase, putative (EC:1.1.1.105)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    IscW_ISCW021418
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    IscW_ISCW021418
Enzymes [BR:isc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     IscW_ISCW021418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 349 aa AA seqDB search
MLGSLEFFTRIVAAVYSFFFAPDCGIFRDVRFTGHGKRVLVSGCDSGIGLRTAERLHKAG
YQVLAGCLSDQSDGARKLSLLKGPHPVVVLQLDITKQDSVREALKKAEVQEKVFLYMFTG
LWGLVNNAGVCVLGEFEWMTQEQVENTFGVNVLGTLRLSKACLPYIRKSKGRLVTITTVM
AVSSFPGMSVYCASKFALETFCDVLRIELSRHGAYASVIRPGDLVKHTRILEAQKSHAQD
MWNAMDSEQQSLYEPYMAAFISGRANSGGMLGTEALDDSPVFGHIEHALGAARPRARYMS
DKSLWPVFLRFLALLPTTLSDALQSLCYRVIFLHYGSQFAEKSTTEKVR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgttgggaagcctggagtttttcacgaggatcgtggctgcggtctacagcttcttcttc
gctccggactgtggcatcttcagggacgtccgctttaccggacacggcaagagagtgctg
gtcagtggctgtgactccggcatcggactccgaactgccgagcggctccacaaggcgggt
taccaagtgctggccggatgcttgtctgaccagagcgatggagccaggaagctgtccctg
ctgaaaggtccacatcctgtggtcgtgctccagttggacatcacgaagcaagacagcgtt
cgggaagcgctcaagaaggcggaagttcaggagaaagtttttctttatatgtttacagga
ctttggggtttggtgaacaacgccggagtctgcgtgctgggcgagtttgagtggatgaca
caggagcaagtcgaaaataccttcggggtcaacgttttgggaactctgcgactgtccaaa
gcctgcctgccttacatccgcaaaagcaaaggacgactggtgaccatcacgaccgtgatg
gccgtgtccagtttccccggaatgagcgtctactgcgccagcaagtttgccctggagacc
ttctgcgatgtcctcagaatagaactgtccaggcatggcgcctacgccagtgtcatccga
ccgggagaccttgtcaagcacaccaggattctggaggctcaaaagtcacacgctcaggac
atgtggaacgccatggacagcgaacagcagagcctctacgagccctacatggcggccttc
atcagcggtcgtgccaacagcggaggcatgctgggcaccgaagcgctggacgactctccg
gtcttcggccacatcgaacacgcgctgggagcggcccgaccgcgggcccgctacatgagc
gacaagagcctgtggccagtcttcctgcggttcctggccctcctacccaccaccctgtcg
gatgccctccagtccctctgctaccgcgtcatcttcctccactacggctcccagttcgcc
gagaaatctacgacggagaaagttcgataa

DBGET integrated database retrieval system