KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW021567Help
Entry
IscW_ISCW021567   CDS       T01131                                 

Definition
stearoyl-CoA desaturase, putative (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:isc01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:isc01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 340 aa AA seqDB search
AHLDGKMLTIVPKEDDRIFPQIINSHSPAVSKPVSKEAEQLQRFKTEIVWRNVAIFAILH
SMALYGMYVALYQAMWKTWIFAYFWGTFAGLGVTAGAHRLWSHRAYRARFPLRMALMVFN
CMACQNDLYEWTRDHRVHHKFSETHADPHNVNRGFFFAHMGWLMCKKHPDVMRKGKAVDC
SDLLRDPVIRFQKKYYVPLTTFFCFYLPAVLPHYMFGETYWNAFFVSTMLRYVFSLNFTW
LVNSAAHLWGCRPYDKHISPAENRFVSWAAIGEGFHNYHHTFPWDYSTSELGWKLNFTTM
FIDCMAAIGLAYDLKTVPKEVIEKRKTRTGDGSYDHLHLH
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gcccatctcgacggtaagatgctgactattgttcctaaagaggacgatcgaattttcccg
cagatcatcaactctcacagcccagcggtctcgaagccggtttcgaaggaggcggaacag
ttgcagaggttcaagaccgagatcgtatggagaaatgtggccatattcgcgattctgcac
agcatggcgctctacggcatgtacgtggccctctaccaagccatgtggaaaacatggatc
ttcgcgtatttctggggcacatttgcgggcttgggagtcacggccggtgcccacagactc
tggtcccacagagcgtacagggctcgcttccccctcaggatggcgctcatggtcttcaac
tgcatggcgtgccagaacgacctgtacgagtggacgagggatcaccgggtccaccacaag
ttctccgagacccacgcggatccgcacaatgtgaaccgaggcttcttctttgcccacatg
ggctggctcatgtgcaagaagcaccccgacgtgatgcgcaagggcaaggccgtcgactgc
tctgacctgctcagggaccccgtcattcggttccagaaaaagtactacgtgcccctgacg
actttcttctgtttctacctgcccgccgtgctaccgcattacatgttcggcgagacctac
tggaacgccttctttgtgtccaccatgctacgctacgtgttctcgctcaacttcacctgg
ctcgtgaacagcgctgcccacctgtggggatgccgcccgtacgacaagcacatctcgcca
gccgagaacagatttgtctcgtgggcggccatcggcgagggcttccacaactaccaccac
accttcccgtgggactactcaactagcgaacttggctggaagctgaacttcaccacgatg
ttcatcgactgcatggccgcaatcggactggcttacgacttgaagaccgtcccgaaagaa
gtgatcgagaagaggaagacccggactggagacgggagctacgaccaccttcacctacac
tga

DBGET integrated database retrieval system