KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW021569Help
Entry
IscW_ISCW021569   CDS       T01131                                 

Definition
stearoyl-CoA desaturase, putative (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    IscW_ISCW021569
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    IscW_ISCW021569
Enzymes [BR:isc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     IscW_ISCW021569
Lipid biosynthesis proteins [BR:isc01004]
 Desaturase
  First
   IscW_ISCW021569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 329 aa AA seqDB search
MAPCTETVMQKSALENVVLKQSEPYERIFVWRNVVKISLVHLMALYGCYEYFYSMWQTHI
FGTIILIFSGISVTAGAHRLWCHRAYKAKMPLRIFLMIFNCMAAQNDIHEWVRDHRVHHK
YSETDADPHNVNRGFFFAHVGWLFLRKHPLVTKKGKAIDCSDVLADPVVRFQMRYYMLLV
TLFSFYLPTVIPHYLWGESCWNAFFTVTMLRLVLSLNFTWSVNSFAHLWGTKPFDKDISP
VETPWVSFFAVGEGFHNYHHTFPMDYSTSELGWKFNMSTMFIDIMAACGQAYDLKSTPKE
IIESRKLRTGDGSRLPNKEYLKVVSKQQG
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttgcacggaaacggtgatgcaaaagtccgctctggagaacgtcgtgctcaag
cagtcggaaccgtacgagaggatcttcgtttggcggaacgtcgtcaagatctccctggtg
cacctcatggcgctgtacggctgctacgagtacttctacagcatgtggcagacgcacatc
ttcggcaccatcattctcatcttctctggcatcagcgtcacggctggagcccacagactc
tggtgccacagggcgtacaaagcgaagatgcctttgaggatcttcctaatgatctttaac
tgcatggcagctcagaacgacattcacgagtgggtccgcgaccaccgcgtgcaccacaag
tactcggagacggacgcggacccgcacaacgtgaaccgtggcttcttcttcgcccacgtg
ggctggctgttccttaggaagcacccgctagtcaccaaaaagggcaaggccatagactgc
agcgacgtcctggcggaccccgtggtcaggtttcagatgaggtactacatgctcctggtg
acgctgttctccttctacttgccgacggtgatacctcactacctctggggagagtcgtgc
tggaacgccttcttcacggtcaccatgctcagactggtgctctcgctcaacttcacctgg
tcggtaaacagcttcgcgcacctctggggcaccaagcccttcgacaaggacatctcgccc
gtcgaaacgccctgggtgtccttcttcgccgtcggcgaaggatttcacaactaccaccac
acttttcccatggactactcgacaagcgagctgggatggaagttcaacatgagtaccatg
ttcattgacatcatggccgcgtgtggacaggcgtacgacctcaagtctacccctaaggaa
atcatcgagagcaggaagctgaggacgggagacgggagtcgactgcccaacaaggaatat
ttgaaggttgtctccaagcaacagggttga

DBGET integrated database retrieval system