KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW021601Help
Entry
IscW_ISCW021601   CDS       T01131                                 

Definition
translation initiation factor eIF3, p35 subunit, putative
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:isc03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 230 aa AA seqDB search
EKEDYEPPAFVKKPVAGDRWEGEDEDDVKDNWDDEDEEKDASATADGAPSVPVAKKKKPL
AQIIAEKEERRRREAEERRAREEANRTPEDEQAEKLRRQRMQEEADLELAKEAFGLNQQE
SDGIDALQPQTKEDFDSLRKALANKLTSCEKSPLYVAFLDDLLRDLSLNMEPDDLKRLSS
SLNAVANEKVKQQKLKHKKKGKKGASLHVGKDDGLDVTLDDYGNEYDDFM
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
gagaaagaagactacgagccgccggcgttcgtcaaaaagccggtggctggtgacagatgg
gaaggcgaggacgaggacgatgtgaaggacaactgggacgatgaagatgaagagaaggat
gcctcggcgactgcagatggtgcgccgtccgtgccggtggcaaaaaagaagaagcccctg
gcgcaaatcatagcagagaaggaggagaggaggaggagggaggcagaggagaggagggcg
agggaggaggccaaccggacgccggaggatgagcaggccgagaagctccggcggcagcgc
atgcaggaggaggcagaccttgagctcgccaaggaggcctttggtctgaaccagcaggag
tccgacggcattgatgccctgcagccccagaccaaggaggactttgacagcctgcgaaag
gcactggccaacaagctcacatcctgcgagaagtctcccctgtatgttgcctttctcgac
gacctcctcagggacctcagcctcaacatggagccagatgacctaaagaggctgtctagc
tccctgaatgctgtggccaatgagaaagtcaagcagcaaaagctgaagcacaaaaagaag
ggcaagaagggggcgagcctgcacgtgggcaaggacgacggcctggatgtaaccctggac
gactatggaaatgaatatgacgacttcatgtag

DBGET integrated database retrieval system