KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW021822Help
Entry
IscW_ISCW021822   CDS       T01131                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:isc00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    IscW_ISCW021822
   04330 Notch signaling pathway
    IscW_ISCW021822
   04350 TGF-beta signaling pathway
    IscW_ISCW021822
   04630 Jak-STAT signaling pathway
    IscW_ISCW021822
   04068 FoxO signaling pathway
    IscW_ISCW021822
Enzymes [BR:isc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     IscW_ISCW021822
Transcription factors [BR:isc03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    IscW_ISCW021822
Mitochondrial biogenesis [BR:isc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    IscW_ISCW021822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1851 aa AA seqDB search
MADHLVDGPPTKRQKLSEAGLSSDSADFSSLWALENELPEELMGSGGGPSLGDLGPPSQN
AQQNGTTSVEDTRQHQQLSQLLQSKGVAANHGSPGPKELPKQLGLVVSSSGPLLNGPPQL
GAAQAAMGVRASMAGLLAAGGPNSPHQGPQSGMVGPGVKGPGGLMGQANAGFHGGYGQVM
GSLGGPPQQRPLVPGLGGSMMGIPPRYPSAAVDSSQLQNHGQQSPLGSSLGQQQQGQPPG
PQGAPPGGGPPAPPQQQGPGHPSPGAGVAPPLGAAAPSTADPEKRKLIQQQLVLLLHAHK
CQRRESQAANGEVRQCSLPHCRTMKNVLNHMTNCQAGKTCPVPHCASSRQIISHWKNCTR
NDCPVCLPLKQASDRRQQQAGAAVQPTQPSQSPAPADMQRAYAALGLPYNAAGGASVNQL
VNRGQGVSQMNDLQQVGPGSHCSPQDLLSGPGANPVASQPGAPPGGGAASLGAQAPQRPP
LGPSNQSRGPSGRGWGPTWLYALLSVQARKSHPDPVSGVGSVVPPNQVAPTGGGPGGVSL
TQPAGIAKDWHQSVTRDLRHHLVLKIVQAIFPTPEPATLQDRRMNKLVAYAKMVEGDMYE
MANSREEYYHLLAEKIYKIQKELEEKRRKSKEQQQQQQQQMHVGAPQMGQGGGPSHLPGG
ASLGGGQRMAPPNITVPGPFPSNSLGAPQGSGPGGFAGGPLQQQQQQSGAVGGLSFGGGA
GGGSSNALSSGLDGAIGGLNSQFPQTQQFEAMKRHLIQQQAQQLMNQANQVQLSGNANSG
ASVQMSQMLQSQLNSTSVGGPGSQHQQQSQQQQQVQSLGGPLGGGPPMLPQASTPQPQQQ
APPPQHPPRAQSVPTTLGGSQPPTPLGGGGGATPVSSTGNVLPPPSHQLPEQILATEDSV
PEDCKPDQDLSLTLSTPEGSAAPTPAQQGKKSIENLDSSGGPKSMLDSSSSGNGGGGKME
VDCKPDLRSIGKGKGLDMPGENGLPSFGPVKEEPMSVKEEPVATPAGGSGETGATAAAAV
KPEVKPDIKTEPAAAEASSASSPPKPRPNKKIFKPDELRQALMPTLEKLYRQDPHSLPFR
QPVDPLLLQIPDYFDIVKKPMDLSTIKRKLDTGQYQDPWQYVDDVWLMFDNAWLYNRKTS
RVYRYCTKLSEEFEQEIDPVMQSLGYCCGRKFVFQPQVLCCFGKQLCTIPRDAKYWSYQN
RYTYCQKCFAEIPGDTVTLGDDPTQAQTTIRKDQFVEMKNDHLELEPFVECLDCGRKLHQ
VCVLHFDNIWPEGFTCENCLKQKGKKRKENKFTAKPGEVSIRVVACTDKLVEVKPGMKNR
YVDTGHWPGQFPYRAKALFAFEEIDGTDTCFFGMHVQEYGSDCHPPNTRRVYIAYLDSVH
FFRPKQYRTAVYHEILLGYLDYVKQLGFAMAHIWACPPSEGDDYIFHCHPPEQKIPKPKR
LQDWYRMMLDKGIIERIVLEYKDILKQATEDNLTSASELPYFEGDFWPNVLEESIKELDQ
EEEEKRKAAEALAASAAASEGSQDGEPEGTELGEKKGQKSGRNKKANKSKSNQRKNNKKS
SVPHTGNDLSAKIYSTMEKHKEPGAGAKPAGPPVGALQAVQQVQAAAARQQAPHLAPPGG
YGKGAPPLQKPLAPAGPRMMPMRWESPPYGQPPQQGLGVGPPIRQQGPPPGQMVPPGAQM
GPPNVGGPQRPSQMTPALQQLIQTLKSPASPQQQQQGGPTGPGSDGYPPFAPPLKQSPLS
PQQLMQQVRSPPPGQLVRSPQPSPRPIPSPRQQPIPSPHYPSQTHSPHLGGGLVEGPPGG
DLMLPQGGLAPPGGPSPGPDLTPQQLAPPQGSDGSELLTPQEQLNKFVENL
NT seq 5556 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccatcttgtcgacggaccgccgacgaagcgacagaagttgtcagaagcgggc
ctctcgtcggatagcgctgacttcagcagcctctgggccttggagaacgagctcccagag
gagctgatgggctccggcggaggcccctcgctcggcgacctgggcccgccctcgcagaat
gcacagcagaacggcacaacgagcgtcgaggacacgcggcagcaccagcagctctctcag
ctgctacagagcaagggggtggcggccaaccatggcagccccggcccgaaggagctgccc
aagcagctgggcctggtggtgagctcctcgggccccctgctgaacggccctccgcagctg
ggggccgcccaggcagccatgggggtgcgtgcatctatggcggggctgctggcggccggt
ggccccaactccccgcatcagggtccccagtcggggatggtgggccctggagtcaagggt
cctggagggttgatgggccaggcgaacgccggtttccacgggggctacggccaggtcatg
ggatctctgggtggaccaccgcagcagaggccactggtcccgggcctggggggcagcatg
atgggaataccaccccggtaccccagtgcggccgtggactcctctcagctgcagaaccac
ggccagcagagtcccctgggctcctccttgggccagcagcagcagggccagcccccaggg
cctcaaggggcaccccctgggggcggacctcccgccccaccccagcagcaaggaccaggc
cacccgtcgcccggggccggggtagctcctcccctcggcgcggcagcgccctcgacggcc
gacccggagaagcgcaagctgattcagcagcagctcgtgctcttgcttcacgcgcacaag
tgtcagcggcgggagtcgcaggcggccaatggagaggtgcgccagtgctcgcttcctcac
tgccgtacgatgaagaacgtgctgaaccacatgaccaactgccaggcgggcaagacatgc
ccagtgccccactgcgcctcctctcggcagatcatctcgcactggaagaactgcacccgc
aacgactgcccggtctgtctaccgctcaagcaggcctcggacaggcggcagcagcaagcc
ggtgcggcggtgcagcccacgcagcccagccagagcccggctcccgcggacatgcagcgg
gcgtatgcggccctggggctcccctacaacgcggccggcggggccagcgtcaaccagctc
gtcaacagggggcagggcgtctctcagatgaatgacctgcagcaggtgggccctgggagc
cactgctcccctcaggacctgctctcgggccctggcgccaaccccgtggcctcccagcca
ggggcgccccccgggggaggggcggcatccctgggggcacaggcgccccagaggccaccc
ctgggaccctccaaccaaagtaggggtccttcagggaggggctggggacccacctggctt
tacgcgttgctctcggtccaggctcgtaaatcccaccctgatccggtctcgggggtgggc
tccgtggtgccacccaatcaggtggcgccgaccggcggcggccccggcggtgtgagcctc
acccagcccgccggcatcgccaaggactggcaccagtcggtcacgcgggacctcaggcac
cacctggtcctcaagatagttcaagccattttccccacccctgagccagccactctgcag
gatcggaggatgaacaaactagtcgcttatgccaagatggtcgaaggagacatgtacgag
atggccaacagcagggaggagtactaccacctgctggcggagaagatctacaagatccag
aaggaactggaggagaagcggcggaaaagcaaggagcagcagcagcaacaacaacaacag
atgcacgtcggcgcgccccagatggggcaagggggcggcccctcccacctcccggggggc
gcgtccctcggcgggggtcagcgcatggcgccccccaacatcacggtgccgggccccttc
ccatccaactcgctgggagcgccgcagggaagcggtcccgggggcttcgcggggggcccc
ctccagcaacagcagcagcagtcgggggccgtgggtggactctcgttcggaggcggggcc
gggggcggcagctccaacgccctctcgtccggcctggacggggccattgggggcctcaac
agccagttcccacagacgcagcagttcgaggccatgaagcggcacttgattcagcagcaa
gcgcagcagctgatgaaccaggcaaatcaagtccagctttccggcaacgcaaactctggc
gcgtcggtgcagatgtcccagatgctgcagtcccagctcaactccacgtcggtggggggg
cccggcagccagcaccagcagcagtcccagcagcaacagcaagtgcaatccctgggaggt
cccctgggagggggacctccgatgctgccccaggcttcgacgccccagccccagcagcag
gcgccccctccgcagcatcccccgagggcccagtccgtgcccacgacgctcggcgggtcc
cagcccccgaccccgctggggggaggagggggcgccacaccggtgtcttcaacgggcaac
gtgttgccgccgccctcgcaccagctcccggagcagatcctggccacggaggactcggtg
ccagaggactgcaagccggaccaggacctgtcgctcaccctgtccacacccgaggggtcc
gccgcccccacgcccgcccagcagggcaaaaagtccattgaaaacctggactcctccggg
ggccccaaatcgatgctggactcctcctcgtccggcaacgggggaggaggcaagatggag
gtggactgcaagccggacttgcggtccatcggcaagggcaagggactggacatgcctggg
gagaatgggctaccatcgtttggcccagtcaaggaggagcccatgtcagtcaaggaggag
cccgtggccacgccggcaggcggatcaggggagaccggagccacggcggcggccgcggtc
aagccggaagtcaagccggacatcaagacggagccagcggcggcggaggcgtcctcggcg
agctccccgcccaaacccagaccgaacaagaagatcttcaagcccgacgagcttcgtcag
gccctcatgccgactctggagaagctgtacaggcaggacccccactcgctccccttcagg
cagcccgtggaccccctcctcctgcagattcccgactactttgacattgtgaagaagccc
atggacctgtcgaccatcaaacgaaaactggacacgggtcagtaccaggacccgtggcag
tacgtggacgacgtatggctcatgtttgacaacgcctggctctacaaccgcaagacctcg
cgtgtctaccgctactgcaccaagctgtcagaagagttcgagcaggagatagatcccgtg
atgcagtcgttggggtattgctgcggccgaaagtttgtgtttcaaccgcaagttctgtgc
tgctttggcaagcagctttgcaccatccctagggatgccaagtactggagctaccaaaac
cggtacacctactgccaaaagtgctttgctgagattcctggtgataccgtgactctgggc
gacgatccaactcaagcccagacgaccattcgcaaggaccagtttgtcgaaatgaagaac
gaccatctggagctcgagccgttcgtggaatgcctcgactgcggccgcaagctgcatcag
gtgtgcgtacttcactttgacaacatctggcccgaaggtttcacctgcgagaattgccta
aagcagaaaggaaaaaagcggaaagagaacaaattcacagccaaacccggggaagtgagc
atccgggtggtagcctgcaccgacaaactggtggaggtgaagcccggcatgaagaacaga
tacgtggacacgggccactggcccggccagttcccctaccgggcgaaggcactgtttgcc
tttgaagagatcgacgggacggacacgtgcttcttcgggatgcatgtgcaagagtatggg
tcggactgccatccgcccaacacccgccgggtctacatcgcctacctggacagcgtccac
ttcttccgacctaagcagtaccgcacggctgtctatcacgagattctccttggatacctc
gactatgtcaagcagcttggtttcgcaatggcgcacatttgggcgtgcccaccgagcgaa
ggggacgactacatttttcactgccaccctccggagcagaagatcccaaagcccaaacgg
ctacaggactggtacaggatgatgctggacaagggcatcatcgagaggatcgtgctagag
tacaaggacattctgaaacaggccacggaggacaacctgacgagcgcctcggagctgccc
tacttcgagggggacttctggcccaacgtgctggaggagagcatcaaggagctggaccag
gaggaggaggagaagcgcaaggcggccgaagccctggccgcctccgccgccgcctccgag
ggctcccaggacggagagcctgagggcacagagctgggcgagaagaagggccagaagagt
gggcgcaacaagaaggctaacaagagcaagagcaaccagcgcaagaacaacaagaagtcc
tctgtgccccacacgggcaacgacctctcggccaagatatactccaccatggagaagcac
aaagagccgggggccggggccaagccagcgggtccgcccgtgggagcgctgcaggccgtg
caacaggtgcaggcagcggcggcgcgccagcaggctccccacctggccccgccggggggc
tacggcaagggggctccccccctgcagaagcccctggcccccgcaggtccccgcatgatg
ccgatgcgctgggagagcccgccctacggacagcccccacagcagggcctcggggtgggg
ccccccatccggcaacagggcccaccccccggccagatggtgccccccggggcccagatg
gggccccccaacgtgggcgggccccagcggcccagccagatgacgcccgccctgcagcag
ctcatccagacgctcaagtcccccgcgtcgccccagcagcagcagcaggggggccccacg
gggcccggcagcgacggctacccgcccttcgcacccccgctcaagcagagccccctgagc
ccccagcagctgatgcagcaggtgcggtcgccccccccgggccaattggtgcgctccccc
caaccctccccccgccccatcccgtcgccacggcagcagcccatcccttcgcctcactac
ccgagccagacgcactcgccccacctgggcggcggtctggtcgagggcccccccgggggc
gacctgatgctgccccagggcgggctggctccccccggtggccccagcccggggcccgac
ctcaccccgcagcagctggcacccccgcagggctcggacggttcggaactcctcacccct
caggagcagctcaacaagttcgtggagaacttgtag

DBGET integrated database retrieval system