KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW021966Help
Entry
IscW_ISCW021966   CDS       T01131                                 

Definition
mitogen-activated protein kinase, putative (EC:2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
FoxO signaling pathway
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:isc00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    IscW_ISCW021966
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     IscW_ISCW021966
Protein kinases [BR:isc01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   IscW_ISCW021966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 359 aa AA seqDB search
PSAVTMKSGFHKVELNKTVWEVPARYTNLSPIGVGAYGQVCSALDKELKQKVAIKKLSRP
FQSAIHAKRTYRELRLLKHMDHENVIGLLDVFTPSTTLEDFQDVYLVNHLMGSDLNNIIR
TQRLSDDHVQFLVYQILRGLKYIHSAGIIHRDLKPSNIAVNEDCELKILDFGLARHAEVE
MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELITSKTLFPGNDHINQLNRIMAL
CGTPDEELLGKISSKEARNYIRSLPVMKKKNFSEVFQGANAKAVDLLERMLELDADKRPT
ATEALAHPYLASLADPTDEPTAEPCDQSFEDRELSVHEWRRLVYEETVSFVPSPANSDL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
ccgtccgccgtcacgatgaagagcggctttcacaaagtggaactcaacaagactgtctgg
gaggtgccagcccggtacaccaatctgtctcccatcggcgttggagcctacgggcaagtc
tgctcggcactggacaaggagctcaagcagaaggtggcgatcaagaagctgtcgcggccg
ttccagtctgccatccacgccaagcgcacataccgagagctccgcctcctcaagcacatg
gaccacgaaaacgtgattggcctgctggacgtgttcacaccgtcgacaactctggaggac
tttcaggacgtgtacctcgtgaaccacctgatgggctccgacctgaacaacataattcgg
acccaacgcctgagcgacgaccatgtccagtttctcgtctaccagatcctcaggggactc
aagtacatccactcggcgggaatcattcacagggatctcaagcctagcaacattgcagtg
aacgaggactgcgaactcaagatcctggactttggcctggcacgccatgcggaggtggag
atgaccggctacgtggcgacgcgctggtacagggcacccgagattatgctcaactggatg
cactacaaccagacggtggacatctggtcggtgggctgcatcatggctgagctcatcacg
tccaagaccctgttccctggaaacgaccacataaaccagctgaaccggatcatggcgctg
tgtggcacaccggacgaggagcttctcggcaaaatctctagcaaagaggctcgaaactac
atccggagtttgccggtcatgaagaagaagaacttctccgaggtgttccagggggccaac
gccaaggcggtggacctgctggagcgcatgctggagctggacgcggacaagcgccccacg
gccacggaggccctggctcacccgtacctggccagcctggccgaccccacggacgagccc
accgctgaaccctgcgaccagtccttcgaggaccgcgagctcagtgtgcacgagtggagg
cggctggtgtacgaggagaccgttagctttgtgccgtcccccgccaactcggacctctag

DBGET integrated database retrieval system