KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW021968Help
Entry
IscW_ISCW021968   CDS       T01131                                 

Definition
OTU domain-containing protein, putative
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     IscW_ISCW021968
Peptidases [BR:isc01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   IscW_ISCW021968
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 526 aa AA seqDB search
MTILPTKKASQQKSSEGDGAESSSFHGDRHSGHATEGYNFQSRTSPPPRWPAASRDEKRP
AHGSSATFDEFDGVDGGPSHSKRRHRASPHRSLRKAHGHSHSMLGHRATGVVVTNFGKAG
TSQGGSNSSAAEDAVSAQEDSDPSGYNSGDEYDKPPELWTAEEFKEREYHFEKKLRKKGL
MIKSMGEDGACLFRAVADQVYGDQEMHKVLRKLCMDYMAKNSDYYSQYVTEDFEKYVERK
RSDHIHGNHIEMQALSEMFNRPIEVYHYSSEPINIFHGMQQTDNEPIRLSYHRNVHYNSI
IDPYKATVGVGLGLPAFKPGHADKTLVKEALRASEELELEQAMLEDKLRATDWEATSEAI
EEQVARESYLHWLRDNEMRSRKKVGGGASASSSPRGGTAGGMAMGRSSPRSRASPRSSSH
ASQQEATLPSTKTPSEKGFSPKAGSSGLSGAVLQDVGGTSSCSAQEEGFSLVETASFLNH
LPPSMFGLTDWEDSDIIARVLAQSQQEYLDSLKRASGNSSASSSPA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcctcccgaccaagaaggcctcgcagcagaagagcagcgaaggggacggcgct
gagtcgagttcgttccatggcgaccgtcactcgggccacgcgaccgagggctacaacttc
cagagtcggacttctccgccgccccggtggcccgccgcgtcgagggatgagaagagaccg
gcgcacggttccagtgcgaccttcgatgagttcgacggcgtcgacggagggccgagccac
tcgaagcgaaggcatcgggcctcgcctcatcgcagcctgcgcaaggctcacggccactcg
cactcgatgctcggacacagggcgacgggggtggtggtgaccaacttcggcaaggcgggc
acctcgcaaggcgggagcaacagctcagccgccgaagacgccgtgtcagcgcaggaagac
tccgatccgagcggatacaatagcggcgacgagtacgacaagcctcccgagctgtggacg
gccgaagagttcaaagagagggaatatcatttcgagaagaagcttcggaaaaaggggctc
atgatcaagagcatgggggaggacggagcctgcctcttccgggccgtggcggaccaagtc
tatggagaccaagaaatgcacaaggtgctgcgcaaactctgtatggactacatggcgaag
aactcggactactactcccagtacgtgaccgaggacttcgagaagtacgtggagcgtaag
cgcagcgaccacatccacgggaaccacatcgagatgcaggcactttcggagatgttcaac
cgccccatcgaggtgtaccactacagctccgagcccatcaacatcttccacgggatgcag
cagacggacaacgagcccatccggctgagctaccaccgcaacgtgcactacaactccatc
atcgacccgtacaaggccaccgtcggggtgggcctgggactacccgccttcaagcctggg
catgcggacaagactctggtgaaggaggccctgcgagcctcggaggagctggagctggag
caggcgatgttggaggacaagctgcgtgccaccgactgggaggcgacgagcgaggccatt
gaggagcaagtggcccgagagtcctacctgcactggctgcgtgacaatgagatgcgctcg
cgcaagaaggtggggggcggagccagtgcttcctcctccccccgaggtgggactgcaggg
ggcatggctatgggaaggtcctccccccgctcgagggcaagcccaaggtcgagtagccat
gcctctcaacaggaggcaacgctaccaagcaccaaaacgccttccgagaaaggattcagt
cccaaggccggcagttcgggcctctctggcgcagtgctgcaggacgtgggcgggacttcg
tcgtgctccgcccaggaggaggggttttccctggtcgagactgcctctttcctcaaccac
ctgcctccctctatgtttggcctgacggactgggaggactcggacatcattgccagggtg
ctggcccagtcccagcaggagtacctggactccctcaaacgtgcttccggcaactcctcg
gcctcctcctctccggcc

DBGET integrated database retrieval system