KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW021968Help
Entry
IscW_ISCW021968   CDS       T01131                                 

Definition
OTU domain-containing protein, putative
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
isc  Ixodes scapularis (black-legged tick)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 526 aa AA seqDB search
MTILPTKKASQQKSSEGDGAESSSFHGDRHSGHATEGYNFQSRTSPPPRWPAASRDEKRP
AHGSSATFDEFDGVDGGPSHSKRRHRASPHRSLRKAHGHSHSMLGHRATGVVVTNFGKAG
TSQGGSNSSAAEDAVSAQEDSDPSGYNSGDEYDKPPELWTAEEFKEREYHFEKKLRKKGL
MIKSMGEDGACLFRAVADQVYGDQEMHKVLRKLCMDYMAKNSDYYSQYVTEDFEKYVERK
RSDHIHGNHIEMQALSEMFNRPIEVYHYSSEPINIFHGMQQTDNEPIRLSYHRNVHYNSI
IDPYKATVGVGLGLPAFKPGHADKTLVKEALRASEELELEQAMLEDKLRATDWEATSEAI
EEQVARESYLHWLRDNEMRSRKKVGGGASASSSPRGGTAGGMAMGRSSPRSRASPRSSSH
ASQQEATLPSTKTPSEKGFSPKAGSSGLSGAVLQDVGGTSSCSAQEEGFSLVETASFLNH
LPPSMFGLTDWEDSDIIARVLAQSQQEYLDSLKRASGNSSASSSPA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcctcccgaccaagaaggcctcgcagcagaagagcagcgaaggggacggcgct
gagtcgagttcgttccatggcgaccgtcactcgggccacgcgaccgagggctacaacttc
cagagtcggacttctccgccgccccggtggcccgccgcgtcgagggatgagaagagaccg
gcgcacggttccagtgcgaccttcgatgagttcgacggcgtcgacggagggccgagccac
tcgaagcgaaggcatcgggcctcgcctcatcgcagcctgcgcaaggctcacggccactcg
cactcgatgctcggacacagggcgacgggggtggtggtgaccaacttcggcaaggcgggc
acctcgcaaggcgggagcaacagctcagccgccgaagacgccgtgtcagcgcaggaagac
tccgatccgagcggatacaatagcggcgacgagtacgacaagcctcccgagctgtggacg
gccgaagagttcaaagagagggaatatcatttcgagaagaagcttcggaaaaaggggctc
atgatcaagagcatgggggaggacggagcctgcctcttccgggccgtggcggaccaagtc
tatggagaccaagaaatgcacaaggtgctgcgcaaactctgtatggactacatggcgaag
aactcggactactactcccagtacgtgaccgaggacttcgagaagtacgtggagcgtaag
cgcagcgaccacatccacgggaaccacatcgagatgcaggcactttcggagatgttcaac
cgccccatcgaggtgtaccactacagctccgagcccatcaacatcttccacgggatgcag
cagacggacaacgagcccatccggctgagctaccaccgcaacgtgcactacaactccatc
atcgacccgtacaaggccaccgtcggggtgggcctgggactacccgccttcaagcctggg
catgcggacaagactctggtgaaggaggccctgcgagcctcggaggagctggagctggag
caggcgatgttggaggacaagctgcgtgccaccgactgggaggcgacgagcgaggccatt
gaggagcaagtggcccgagagtcctacctgcactggctgcgtgacaatgagatgcgctcg
cgcaagaaggtggggggcggagccagtgcttcctcctccccccgaggtgggactgcaggg
ggcatggctatgggaaggtcctccccccgctcgagggcaagcccaaggtcgagtagccat
gcctctcaacaggaggcaacgctaccaagcaccaaaacgccttccgagaaaggattcagt
cccaaggccggcagttcgggcctctctggcgcagtgctgcaggacgtgggcgggacttcg
tcgtgctccgcccaggaggaggggttttccctggtcgagactgcctctttcctcaaccac
ctgcctccctctatgtttggcctgacggactgggaggactcggacatcattgccagggtg
ctggcccagtcccagcaggagtacctggactccctcaaacgtgcttccggcaactcctcg
gcctcctcctctccggcc

DBGET integrated database retrieval system