KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW022060Help
Entry
IscW_ISCW022060   CDS       T01131                                 

Definition
hypothetical protein
Orthology
K04437  
filamin
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Exosome [BR:isc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   IscW_ISCW022060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 834 aa AA seqDB search
MPSGRVDKPVIIDNQNGTVSIQYEPREEGQHELHIKFNQEHIQGSPFRFHVDTIQSGYVT
AYGPGLTHGVAGEPSNFSISTKDAGAGGLNVAVEGPSKAEISVHDNKDGTVAVSYLPAAP
GEYKISVKFADKPIKGSPFTAKITGEGRKRNQISVGHSSEVSLKVQEKDVKNLNASIVAP
SGLEEPCFLKKLPNGHLGISFTPRETGEHLINVKRVGTHITGSPFKINVLPQEIGDASKV
KVTGKALSEGATQVRNEFSIDTREAGYGGLSLSVEGPSKADIQCKDNEDGTLKVSYMPTE
PGYYIVNLKFADHHVKGSPFTVKVTGKGSNIQRENIKKQREAAPTAEVGSKCQFTFKMPG
TSGFDMAARVTSPSGSSEDAEIADLDDCQYAVHFVPKESGVHTVSVRHKDIHIPGSPFQF
TVGPFRDHGAHRVHAGGPGLERGIAGDSCEFNVWTREAGAGSLSLSVEGPSKAQIDFKDR
KDGSCYVTYKVKDPGEYRVGIKFNDQHIPDSPFKVYVMPQAGDASKIELGSVAENMQTNK
PVAFTISMNGARGNLDGKVVSPSGHEDDCFVAPLDDDQWALRFVPRENGIHQIHIRFNGV
HIPASPFRVRIGKDDADPAAVHAYGPGLRDAKSGTPSQLEYHSLKKIERMHFSNDSDNFR
NKDHRGSRNKDHKMTNSKDLVFNYIPILFGDVIVESLPTCIDTSPKGLSIAPPTAPETSS
MTVDTVVKQAVQKADHLPKFRSNAGKVTSKGLGLKRAVLNKQNTFTVNCLDAGNNLIYAS
VYGPKGPCDEVFVKHLGRNLYQVNYVVKDRGDHVVIVKWGDDHIPGSPFKVEVV
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgggacgagtggacaagccggtcatcatcgacaaccagaacggcaccgtcagc
attcagtacgagccgcgggaggaagggcagcatgaactgcacatcaagtttaaccaggag
cacatccagggttcccccttcaggttccacgtggacaccatccagagtggctacgtgacc
gcgtacggaccgggactcacgcatggcgttgctggagagcccagcaacttctctattagc
accaaggatgctggagccggcggtctcaacgtggccgttgagggcccgtccaaagccgag
atcagcgtgcacgacaacaaggacggcacggtggccgtatcctaccttccggcggcgccc
ggagagtacaaaatctcggtgaagttcgccgacaagcccatcaagggaagccccttcacg
gccaagatcaccggcgagggccgcaagcgcaaccagatctctgtgggccactcaagcgag
gtgtctctcaaggtccaggagaaggacgtgaagaacctcaacgccagcatcgtggcgccc
tccggcctggaggaaccttgcttcctcaagaagctgcccaacggtcacttgggtatctcg
ttcacgccccgtgagaccggcgagcacctgatcaacgtgaagcgcgttggtacccacatc
actggcagccccttcaagatcaacgtgctgccgcaggagatcggcgacgcgtctaaggtc
aaggtgaccggcaaggccctatccgaaggcgccacccaagtgcgcaacgaattctccatc
gacacccgcgaggccggctacggaggcctgagcctttcagtggaaggccccagcaaggcg
gacatccagtgcaaggacaacgaggatggcacgctcaaagtgagctacatgcccacggag
cccggctactacatcgtcaacctcaagttcgccgaccaccacgtcaagggctctccgttc
acggtcaaagtgacgggcaagggctccaacatccagcgcgagaatatcaagaagcagcgg
gaagccgccccgacggccgaggtcggctccaagtgtcagttcaccttcaagatgcccggc
actagcgggtttgacatggcggcgcgcgtgacgtccccgtcgggcagttctgaggacgcc
gagattgcggacttggacgactgccagtacgccgtgcactttgtgcccaaggagtccggc
gtgcacacggtcagcgttcgccacaaggacatccacatcccgggttcgccgttccagttc
accgtggggcccttccgagaccacggcgcgcaccgcgtccacgccggcgggcccggcctc
gagcgcggcatcgccggagactcctgcgagttcaacgtttggacccgggaggctggagcc
ggcagcctgtccttgtcagtcgaaggaccctccaaggcacagattgacttcaaggaccgc
aaagacggctcctgctacgtgacttacaaagtcaaggatcccggcgagtaccgcgtgggc
atcaagttcaacgaccagcacatcccggacagcccgttcaaggtgtacgtgatgccccag
gcgggcgacgccagcaagatcgagctgggcagcgtggcggagaacatgcagaccaacaag
ccggtggccttcactatctccatgaacggggccaggggtaacctagacggcaaggtggta
tcgcccagcggtcacgaggacgactgcttcgtggcgccactggacgacgaccagtgggca
ctgcgcttcgtgccccgcgagaacggcatccaccagatccacattcgcttcaacggcgtc
cacatcccggcgagtcccttcagagtccgcatcggcaaggacgacgccgaccccgccgca
gtccacgcctacggaccgggactcagagacgccaagagcggtacgccgtcacaactggaa
tatcattcgttgaaaaagatagaaagaatgcatttttcaaacgactctgataattttaga
aataaagaccatagagggtcgagaaataaagaccataaaatgacgaatagtaaagacctc
gtgtttaactacataccgatcctctttggagacgtcatcgtcgaatcattaccaacctgc
atagatacttcgccaaaagggctgtccatcgcccctccgactgcgcccgagacgtcctcg
atgacggttgacacggtggtcaagcaggccgtccagaaggccgaccacctgcccaagttc
cgctccaacgccggcaaggttaccagcaagggcctgggtctaaagcgggccgtgctcaac
aagcagaacaccttcacggtcaactgtctggacgccggcaacaacctgatctacgccagc
gtgtacggacctaagggaccctgcgacgaggtgttcgtcaaacacctgggccgcaacctg
taccaggtcaactacgtggtcaaggaccgcggagaccacgtggtcatcgtcaagtgggga
gacgaccacatcccgggcagcccgttcaaggtcgaggtcgtctag

  All links  
No link information was found.   
DBGET integrated database retrieval system