KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW022153Help
Entry
IscW_ISCW022153   CDS       T01131                                 

Definition
ubiquitin C-terminal hydrolase, putative (EC:3.4.19.12)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
isc  Ixodes scapularis (black-legged tick)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 377 aa AA seqDB search
TMPVDLNRLADGWLQLESDPGLFTLLLEDFGVKGVQVDEIYDLQKSIEGPVYGFIFLFKW
IEERRSRRKVVTRTEEVAREEVWALRDPLISFQIVPNSCATHSLLSILLNCSKIYLGSTL
TRLKEHTRHMDPENKGHAIGNTPELARAHNTHAKPEPPQEKGHGVATGRTLEAFHFVSYV
PIDGRLYELDGLKPFPIDHGPWQPGQDWTDKFRMVITERLGGGDIRFNLMAVVPDRRQAY
EHKLRTLKTNRGIVLEALQHMVGALSSWPVGAAGGDLDRLVVVRLGEEHPFAPHDLLALL
KTVEAEIGACEAALRDELDRRRKYVVDDCRRTHNYDQFICTFLSMLAEQGQLADLVEQQL
QPRRRPPKDRSRPRRRR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
acgatgcccgtggacttgaaccgcctggctgatggctggctgcagctggagagcgatcca
ggcctgttcacgctgctactcgaggacttcggcgtcaagggggtccaggtggacgagatc
tacgacctgcagaagtccatcgaagggcccgtgtacggcttcatcttcctcttcaagtgg
atcgaggagaggcgttcgcggcggaaggtggtcaccagaacagaagaggtggcaagagaa
gaggtatgggctttacgtgaccccttaatctcgttccagatcgtgcccaactcgtgcgca
actcactcgctgctgagcatcctgctgaactgctccaagatctacttgggctcgacgctg
acgcggctgaaggagcacacgcggcacatggacccggagaacaagggccacgccattggc
aacacccccgagctggcacgcgcacacaacacgcacgccaagcccgagcctccgcaggag
aagggccatggcgtggccacggggcgcaccctggaggccttccacttcgtgagctacgtg
cccatcgacggccgcctctacgagctggacgggctcaagcccttccccatcgaccacggg
ccctggcagcctggccaggactggaccgacaagttccgcatggtgataacggaacgcctg
gggggcggggacatccgcttcaacctgatggcggtggttccggaccgtcgccaggcttac
gagcacaagctgcgcaccctcaagaccaaccggggcatcgtgctggaggccctgcagcac
atggtgggtgccctctcctcatggccggtgggggccgccggcggggacctggaccgcctg
gtggtggtgcggctgggggaggagcacccctttgccccccacgacctgctcgccctcctc
aagaccgttgaggccgagatcggggcctgcgaggctgccctccgggacgagctcgacagg
cggcgcaagtacgtggtggatgactgccggcgcacgcacaactacgaccagttcatctgc
acgttcctgtcgatgctggccgagcaggggcagctcgcagacctggtggagcagcagctg
cagccccgccgcaggccccccaaggaccgcagccggcccaggcgcaggcgctga

DBGET integrated database retrieval system