KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW022190Help
Entry
IscW_ISCW022190   CDS       T01131                                 

Definition
cyclin T-dependent kinase CDK9, putative (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     IscW_ISCW022190
Protein kinases [BR:isc01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   IscW_ISCW022190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 461 aa AA seqDB search
LPYKFRDSGQAPLRKLSVDLIKTYKHINEVYYAKKKRRAQQPQGEDQSHKKERKLYNEGF
DDDNHDYIIRNGERFLDRYEIDSLIGKGSFGQVVKAYDREEQCFVAIKIIKNKKPFLNQA
QIEVKLLEMMNSHESNGTCSVKLKGHFMWRNHLCLVFELLSYNLYDLLRNTNFSGVSLNL
TRKFAQQMCTALVFLSHPDLSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQY
IQSRFYRSPEVLLGIPYDMAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGLPP
KALLDKAHKARKYFEKLPDGSYMLKKAKDGKKYRGAGTRRLHEVLGVETGGPGGRRQSEP
GHSVADYLKFRDLVLRMLDYDPKGRITPHHALQHSFFRRTADEGTNTSTSPAALDGSGAA
VPLALLQGAPHPSQGTQGPSLPPHSNNGASSSSASSGASSC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
ctcccctacaagttcagagactctgggcaggcacccctgcgcaagctcagcgtagacctc
atcaagacctacaagcacatcaacgaggtgtactatgccaagaagaagcggcgtgcgcag
cagccccaaggcgaggatcagagccacaagaaagagcgcaagctgtacaacgaaggcttt
gacgacgacaaccatgattacatcatccgcaacggcgagcggttccttgaccgctacgag
attgactctctcatcggcaagggctcctttggacaggtggtgaaggcatacgacagggaa
gagcagtgctttgtggccatcaaaatcataaaaaacaagaaacccttcctgaaccaagct
caaattgaagtgaagctcctggagatgatgaacagccatgagagcaatggtacctgctca
gtcaagttaaaagggcacttcatgtggcgcaaccacctctgcctggtcttcgagctgctc
tcgtacaacctgtacgacctgttacgcaacaccaacttcagcggggtctccctgaacctg
acgcgcaagtttgcacagcaaatgtgcacggcgctcgtgttcctctctcacccggacttg
agcatcatccactgcgacctcaagcccgagaacattctgctgtgcaatcccaagcgcagt
gccatcaagatcgtcgacttcggcagctcctgccagttggggcagaggatctaccagtac
atccagagtcggttctaccggtctcccgaggtcttgctaggcattccgtacgacatggcc
atcgacatgtggagcttagggtgcatcctggtggaaatgcacacgggagaaccgctcttc
agtggagccaacgaggtggaccagatgaacaaaatagtcgaggtgctgggtcttcctccc
aaagccctgctggacaaagcacacaaggcgcgcaagtacttcgaaaagcttcccgacggc
agctacatgctcaagaaggccaaggacggcaaaaagtaccgtggagcggggacgcgccgg
ttgcacgaggtgctcggggtggaaacgggtggccctgggggtcgccggcagtccgagccg
gggcactccgtggccgactacctcaagttccgagacctggttttacgcatgctggactac
gacccaaagggccggatcacgccgcaccatgcgctgcagcattcgttcttccgtcgcacc
gcggacgagggcacgaacacgtcgacgtctccggcggccctggacggttctggcgcggcg
gtgcccctggccctgctccagggcgcgccccacccctcccagggcacccaggggccctcc
ttgcccccccacagcaacaacggggcctcctcctcctcggcctcctcgggcgccagttcc
tgt

DBGET integrated database retrieval system