KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW022516Help
Entry
IscW_ISCW022516   CDS       T01131                                 

Definition
glycogen debranching enzyme, putative (EC:3.2.1.33)
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    IscW_ISCW022516
Enzymes [BR:isc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     IscW_ISCW022516
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     IscW_ISCW022516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1123 aa AA seqDB search
MRHLAQVLTLTDVVLNHVANETPWIREHPECTYNLKNSPHMKPAFLLDVALHCFTLEIAE
GKWEAEGVPPTISKEEHLDALRRIVNLHWLPLLQLHEFYTINVDALVDVFHQKVIDLGAP
TSAPLPDKPLTVVHHPEFLRNGSTVDMDIALRIFNRNWEPDSPDAPHQIGRCCGELRRCL
EQLNGTQWGLLHSHLQAAVENVVKGCRYLRLQHDGPRKQAVSRANPLVGRYFVVLTDVPV
LNLKEAEKLVFSERAAFVMAHNGWVMNDDPLRNFAEPGSNVYLRRELIAWGDNVKLRYGS
SPEDCPFLWNYMKEYVCESAQLFHGLRLDNCHSTPLPLAEYVLDAARKVRPDLYVIAELF
TSREEVDNLFVNRLGINSLIREAMSAPDARELGRLVYRFGGDPVGSFLAPPVRPLAPCVA
HALFMDMTHDNPSPFEKRSPYDVLPSAAVVAMACCGTGSSRGYDEMVPHHIHVVEEEREF
LPWGQAAAAVHLESGIVAAKRALNQLHFELGKRGYRHVYVDQDSLPNIAAALTLSDLNRV
LFRSDAEERAEGRNCGAYCFQRFGTLVYCGLQGLMSVLSEVRSKNDLGHPMCDNLRAGDW
LMDYIVARLAQEKSTLKVNALPTPRFVKHGSTLVRELALGSVVLAGFVPGAHLPPLSKQL
VPPLPPHRMQGDRREEVCTTLAAGLPHFAAGYMRNWGRDTFISLRGLLLLTGRHQEARFL
LLAFGGCLRHGLIPNLLDKGTHARYNCRDAVWWWLQSVQDYCKEILKNPSMVSTANKRIK
TLSRGDQWEVFSQDMPLEEVIQEAIQRHFEGISFRERNAGYQIDSQMTHEGFNVEAGVDL
RTGFVRGGNAHNCGTWMDKMGSSEKAGNKGHPATPRNGSAVELVGLCKSTLRWLDQMYKE
GFYPYNAVEKTEHGVKTVMTFDQWGSLIKKHFEGCFWVPPANEPTSPDDLHPHLTNRRCI
YKDCYGAAPPWSDYQLRPNFPIAMVLAPELFTVQRAWEALKVVREVLVGPFGMKTLDPSA
RREQIVCPDRKHPLQEWLWPMGYYLRARLYFAHKVANSEAALQEVHAEIREVLANNGQLI
QASPWRGLPELTNRNGDPCLDSCPIQAWSHACLLEVLYDMQKI
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atgcggcatctggcgcaggtgctgactctgacggacgtggtgctgaaccacgtggccaac
gagaccccctggatcagggagcacccggagtgcacgtacaacctgaagaactcgccccac
atgaagcccgcctttctgctagacgtggcgctccactgcttcaccctggagatcgccgag
ggcaagtgggaggccgagggggtgccacccaccatcagcaaggaagagcaccttgacgcg
ctgcggcgcatcgtgaacctgcactggctgcccttgctgcaactgcacgagttctacacc
atcaacgtggacgctctagtggacgtcttccaccagaaggtgattgacctgggtgctccg
acgtcggcaccgctgcccgacaagccgctgacagtggtgcatcacccggagttcctcagg
aacggatccacggtggacatggacatagcactgcgcatcttcaatcgcaactgggagccc
gacagccccgacgctccgcaccagattgggcgctgctgcggcgagctgcgtcgctgcctg
gagcagctgaatgggacccagtgggggctgttgcacagccacctgcaggcggccgtggag
aacgtggtgaagggctgccgctacctccgactgcagcacgacgggccccgcaagcaggcc
gtctccagggccaacccgctcgtcggaaggtactttgtggtgctgacggacgtacccgtg
ctgaacctgaaggaggccgagaagctcgtgttcagcgagcgagcggccttcgtgatggct
cacaacggctgggtgatgaacgacgaccccctacgcaactttgccgagccgggctcgaac
gtgtacctgcggcgggagctcatcgcctggggggacaacgtgaagctgcgctacggcagc
tcgcccgaggactgccccttcctctggaactacatgaaggagtacgtgtgcgagtcggca
cagctgttccacggcctgcggctggacaactgccacagcactccgttgccgctggccgag
tacgtgctcgacgccgctcgcaaggttcggccagacctgtacgtaattgcggagctgttc
acgtcgcgcgaagaggtggacaacctgtttgtcaaccggctgggcatcaactcgctcatc
cgcgaggccatgagcgccccggacgcccgggaactcgggcgcctggtctaccggttcggc
ggtgaccccgtggggagcttcctggcgccgcccgtccggccgctggcgccgtgcgtggcg
cacgccctcttcatggacatgacgcacgacaacccgtcgccgttcgagaagcgctcgccg
tacgacgtgctgcccagcgccgcggtggtggccatggcgtgctgcggcacgggcagcagc
cgcggctacgacgagatggtgccccaccacatccacgtggtggaggaggagcgcgagttc
ctgccgtggggccaggccgccgctgccgtgcacctcgagtccggcatcgtggcagcgaag
agggctctcaatcagctgcactttgagctgggaaagcggggctaccggcacgtctacgta
gaccaggacagcctgccaaacattgccgcggccctgacgctctcggatctgaaccgggtc
ctgttccgatcggatgccgaggagcgggccgagggcagaaactgcggggcctactgcttc
cagaggttcggcaccctggtctactgcggcctgcaggggctgatgtcggtgctgtctgag
gtgcgctccaagaacgacctgggtcacccgatgtgcgacaacctgcgggcgggcgactgg
ctcatggactacatcgtggcacgcctggcacaggagaagagcaccctcaaggtgaatgcc
ctaccgacgccacgctttgtgaagcacggctccaccctggtgcgcgagctggccctgggc
tcggtggtgctggcgggctttgtgccgggcgcgcacctgcccccgctgtccaagcagctg
gtcccgcccctgcccccgcaccggatgcagggagaccgccgggaggaggtctgcaccacc
cttgccgccggcctgccccactttgcggccgggtacatgaggaactggggccgggacacc
ttcatctccctccgcggactcctcctgctcacggggaggcaccaggaagccaggttcctg
ctgctggcgtttgggggctgcctgcggcacggcctgatccccaacctgctggacaagggc
acgcacgcacgctacaactgccgggatgcggtgtggtggtggctgcagagcgtccaggac
tactgcaaggaaattctgaagaatccttcgatggtttcgacagcgaataaaaggataaag
accctctcgcggggtgaccaatgggaggtgttctcgcaggatatgccgctggaagaagtg
attcaggaggcgatccagcggcacttcgagggcatctcgttccgggagcgcaatgcaggg
taccagattgactcgcagatgacccacgaaggcttcaacgtggaggccggcgtcgacctg
cggacgggctttgtgcgcggcgggaacgcccacaactgcggcacttggatggacaaaatg
ggcagctcggagaaggctggtaacaagggccacccggccacgcccaggaatggatctgca
gtggagcttgtgggcctgtgcaagtccaccctgcgctggctggaccagatgtacaaggag
ggcttctacccttacaacgccgtggagaagactgagcacggtgtgaagacggtgatgacc
tttgaccagtgggggtcactgatcaaaaagcacttcgagggctgcttctgggtgcccccc
gccaacgagcccacctccccggacgacctgcacccgcacctgaccaaccggcgctgcatc
tacaaggactgctacggggccgcacccccttggtctgactaccagctgcgcccaaacttc
cccattgccatggtgctggcccccgagctgttcacggtgcaaagggcctgggaggcactg
aaggtggtgcgggaggtgctcgttggacccttcggcatgaagacgctggaccccagcgcg
aggcgagaacaaatagtttgtcctgaccgcaagcatcctctgcaggagtggctgtggccc
atgggctactacctgcgggcgcggctgtactttgcccacaaggtggccaacagcgaggca
gccttgcaggaggtgcacgccgagatcagggaggtgttggccaacaacggccagctcatc
caggcgtccccctggaggggcctgccagaactgaccaaccgcaacggcgacccttgcctg
gactcgtgccccattcaggcctggagccacgcctgcctactggaggtcctctacgacatg
cagaagatctag

DBGET integrated database retrieval system