KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW022612Help
Entry
IscW_ISCW022612   CDS       T01131                                 

Definition
ubiquitin carboxy-terminal hydrolase, putative (EC:3.1.2.15)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     IscW_ISCW022612
Peptidases [BR:isc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   IscW_ISCW022612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 913 aa AA seqDB search
MSFPPLGSSTKMAEGGPHPPDLETQKNDISNLLKKPLKPDDIWYLVDNKWFKQWKKYVGY
DTWDVCGIGEQTTHPGPIDNSPLLKEDNSGETKDHLIDELDYVLLPQEAWDKMVSWYGLT
PGQDPLPRRVIEFGMFVKHCKAGTFSLASFYLCLSTNLEQCITKKFSKVDTIDRIEKEMR
NLFSIPKEKETRLWNRYSSNTYEHLFDRTRTVQEAGLYHGQVIMIEEQNDDGSWSRKSAT
RSYSAVGNNYGNYSNSCNYELHGGGSTPGLCGLANLGNTCFMNAAVQCMSNTPPLTEYFM
EGRHLQELNHSNPLGMKGEVAKSYADLIRVMWSGNCSSTIPRPFKASGLRGFAPQFSGFQ
QQDCQELMAFLLDGLHEDLNRVIHKPYIELRDPDGRPDELVAQEAWHNYQLRNNSIIVDI
FHGLLKSTLVCPDCQKLSVTFDPFCYLSLPLPIRKEKLLELVLVRADPHEKPLKMKVTVI
KMSSIQDVCSSVSRLVGIPADRLLVTEVHNHRFLRVLQNTDPIDTLDRMEVFVYELPQSL
NQDNSTYFLPVYLREKSCRYVSNNCNVPVYQLFSQPFFVSVPAKDCTYDMLYKRILKCLA
RYVTPPKPGEEWWTEENMDKQNGGGNVGSEGGRERAAANGGCPPEVDVLNGSNEESFHDA
DEECADGREEEGGSAAAEEERAPNHKRPAVDKPPRRLFSLHTINENGSLNLDSLEDGKEP
LKLGPRTYLGADWLPQVRARFFKDHVTNDMVVHESMHQRQVAKRQLQLRECLELFTTTEK
LGAEDPWFCPSCRSHKQATKKFDLWSLPRVLIIHLKRFSYNRFWRDKIDTLVEFPISNLR
MHDYIINQKHGPAVYDLIAVANHYGGMGGGHYTAYAKNKETEQWYYFDDNSVSPATEDNV
VSKAAYVLFYAKR
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttccgcctttaggttcttctacaaaaatggcggaaggtggtccccatccaccc
gatttggaaacccagaaaaacgacatctcaaatttgctgaagaagcctctgaaaccagac
gacatttggtacctcgtggacaacaagtggttcaagcagtggaagaaatatgtgggatac
gacacctgggacgtttgtggcattggggagcaaacgacgcatccgggccccatcgacaac
tcgcctctacttaaggaggacaacagcggggagacgaaggaccacctgattgatgagctg
gactatgtgctgctgccccaggaggcctgggacaagatggtctcctggtacgggctcacc
cccggccaggaccccctgccccggagggtcatcgagttcggcatgtttgtcaagcactgc
aaggcaggcactttttctttggcctcgttttacctctgcctaagtaccaacctggagcag
tgcatcacgaaaaagttcagcaaagtggacacaatcgaccggatcgagaaggagatgcgg
aacctgttctcgatcccgaaggagaaggagacgcgcctctggaaccggtacagcagcaac
acctacgagcacctgtttgaccggacgcgcaccgtgcaggaggcggggctctaccatggg
caggtcatcatgattgaggagcagaatgacgatggcagttggtcgaggaaaagtgccacg
cggagttacagtgcagtgggcaacaactacggcaattacagcaacagctgcaactacgag
cttcacggaggtggcagcacacccggtctctgtgggctggccaacctggggaacacctgc
ttcatgaatgccgcagtgcagtgcatgagcaacacccctccgctgacggagtacttcatg
gagggccgccacctccaggagctgaaccacagcaacccactgggcatgaagggggaggta
gcaaagtcttacgccgacctcatccgggtcatgtggtccggaaactgctccagcaccatt
cccaggcctttcaaggcaagtggcctgagggggtttgccccccagttctcgggcttccag
cagcaggactgccaggagctgatggcctttctgctggacggcctgcacgaggacctgaac
cgggtgatccacaagccgtacatcgagctgcgggaccccgacgggaggcccgacgagctg
gtggcccaggaggcctggcacaactaccagctgcgcaacaactccatcattgtggacatc
ttccacgggctgctcaagtcgaccctggtgtgcccggactgccagaagctgtcggtgacc
ttcgaccccttctgctacctgtccctgcccctgcccatcaggaaggagaagctgctcgag
ctggtgctggtgcgcgccgacccccacgagaagcccctcaagatgaaagtgacggtgata
aagatgagcagtatccaggacgtgtgcagctctgtttctcgattggtgggaattcctgcc
gacaggctcctggtgacagaggtccacaatcaccggttcctgagggtgctccagaacaca
gatcctatcgacacgttggatcgtatggaagtctttgtatatgaattgcctcagtcattg
aatcaggataactctacctacttcctgcctgtctacctgagagagaaaagctgccgctat
gtgtccaacaactgcaacgtgcctgtgtaccagctgttcagccagcccttctttgtgtcc
gtcccggccaaggactgcacctatgacatgctctacaagcgcatcctcaagtgccttgcg
aggtatgtgacacccccaaagcctggggaagaatggtggaccgaagagaacatggacaag
caaaatggaggtgggaatgtcgggagtgaagggggtagagaaagagcggcggccaacggc
ggttgtcccccagaggtggacgtgctcaacggcagcaacgaggagtcgttccacgacgca
gacgaggagtgtgcagacgggcgggaagaggaggggggcagcgcggccgcggaagaggag
cgggcgcccaaccacaagcgtcccgccgtggacaagccgcctcggcgcctgttcagcctg
cacaccatcaacgagaatgggtctctcaacctggactccctggaggacgggaaggagcct
ctgaagctggggccccgcacctacctgggcgcagactggctgccccaggtgcgcgcccgc
ttcttcaaggaccatgtcaccaacgacatggtggtgcacgagtcgatgcatcagcggcag
gtggccaagcggcagctacagctgcgggagtgcctggagctgttcacgacgacggagaag
ctgggggccgaggacccctggttctgcccctcgtgccgcagccacaagcaggccaccaag
aagtttgacctgtggagcctgccccgggtgctcatcatccacctcaagcgcttctcctac
aaccgcttctggcgagacaagatcgacaccctcgtcgagttccccatcagcaatctgagg
atgcatgactacatcatcaaccagaagcatggtccagccgtgtacgatctcatcgcagtg
gccaaccactacggcggcatgggtggcggacattacacggcctatgcgaagaacaaggaa
acggagcagtggtattacttcgatgacaacagcgtctctcccgccaccgaggacaatgtt
gtgtcgaaggcggcctacgtgctcttctacgccaagcgc

  All links  
No link information was found.   
DBGET integrated database retrieval system