KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW023148Help
Entry
IscW_ISCW023148   CDS       T01131                                 

Definition
profilin, putative
Orthology
K05759  
profilin
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Exosome [BR:isc04147]
 Exosomal proteins
  Proteins found in most exosomes
   IscW_ISCW023148
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 130 aa AA seqDB search
MSWQAYVDNQIRAQVSCKVAAIAGLTDGAIWAKHEEPNVTITQQELKTIADAIRTNPTVF
NVSGVHLGGEKYICLTAEPCLVRARRGSSAMIAVATNTCDEVMVSLYGVPPGTLNTVVEK
LGDYLRSNNY
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaggcgtacgtggacaaccagattcgtgcacaggtcagctgcaaggttgcg
gcgatagcgggcctcacggacggcgccatttgggcgaaacatgaagaacccaacgtgacg
attacgcagcaggagctgaagaccatcgcggacgcgattcgaaccaaccctacggtgttc
aacgtaagcggagttcatttgggcggcgaaaagtatatctgcctcaccgccgagccctgc
ctggtgcgtgcccgaagaggcagttctgcgatgattgccgttgcgacgaacacctgtgat
gaagttatggttagcctttacggtgttccccccggcacgctcaacacggtggttgagaaa
ctaggagactacctgcggtcaaataactat

DBGET integrated database retrieval system